CD325 (N-cadherin) is a type I transmembrane protein, which forms a complex with catenins, that is linked to the actin cytoskeleton. This complex is important in synapses and for functional plasticity of neurons, and is also essential for embryonic development. Decreased CD325 cleavage caused by mutations in presenilin 1 is associated with Alzheimer´s disease. Besides nervous system, CD325 is expressed on the surface of malignant T cells, and increases their adhesion to epithelia, as well as their ability to invade and metastasize to inflammatory sites.SpecificityThe mouse monoclonal antibody 8F9 recognizes an extracellular epitope of CD370 / CLEC9A (DNGR1), a type II transmembrane protein functioning as an endocytic receptor on BDCA31+ dendritic cells and on a subset of CD14+ CD16- monocytes.Application detailsFlow cytometry: Recommended dilution: 1-4 ?g/ml.
Antibody Isotype:
IgG1 kappa
Monosan Range:
MONOSAN
Clone:
8C11
Concentration:
1 mg/ml
Format:
Purified by protein-A affinity chromatography.
Storage buffer:
Phosphate buffered saline (PBS), pH 7.4, 15 mM sodium azide
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide corresponding to a region (1-20 aa) from the N-terminus of human Presenilin 1 conjugated to Diptheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
IF and WB. Suggested dilution of 1:2,000 is recommended for WB. On SDS-PAGE, the predominant form detected by this antibody is the N-terminal Presenilin 1 fragment of approx 29 kDa. The uncleaved form of Presenilin 1 migrates to approx 45 kDa. Human and mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3M), SDS (1%) in 62.5 mM Tris-HCl pH 6.8 sample buffer heated to 50C for 15 min. The suggested dilution for IF is 1:100 for acetone or paraformaldehyde fixed cells or tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity confirmed by WB and IF using transfected cells, Presenilin 1 knock-out mouse cells, mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Chicken anti-Presenilin-1 (PS-1) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid. PBS with 0.02% Sodium Azide
Host Animal:
Chicken
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Mixture of two human Presenilin 1 peptides (311-322 and 341-352 aa). Both sequences are highly conserved in human, mouse and rat.
Applications:
ELISA,WB
Antibody Isotype:
IgY
Application Details:
WB and ELISA. Suggested dilution of 1:1,000 to 1:4,000. To minimise background staining, a higher concentration of detergent (such as Tween-20) is suggested in the dilution and washing steps. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human Presenilin 1
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Amyloid-beta precursor protein (APP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1/Tip60 and inhibit Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity. Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. May be involved in copper homeostasis/oxidative stress through copper ion reduction. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. FUNCTION: Beta-amyloid peptides are lipophilic metal chelators with metal-reducing activity. Bind transient metals such as copper, zinc and iron. Rat and mouse beta-amyloid peptides bind only weakly transient metals and have little reducing activity due to substitutions of transient metal chelating residues. Beta-APP42 may activate mononuclear phagocytes in the brain and elicit inflammatory responses. Promotes both tau aggregation and TPK II-mediated phosphorylation (By similarity). FUNCTION: The gamma-CTF peptides as well as the caspase-cleaved peptides, including C31, are potent enhancers of neuronal apoptosis. SUBUNIT: Binds, via its C-terminus, to the PID domain of several cytoplasmic proteins, including APBB family members, the APBA family, MAPK8IP1, SHC1, Numb and Dab1. Binding to Dab1 inhibits its serine phosphorylation. Also interacts with GPCR-like protein BPP, FPRL1, APPBP1, IB1, KNS2 (via its TPR domains), APPBP2 (via BaSS) and DDB1. In vitro, it binds MAPT via the MT-binding domains. Associates with microtubules in the presence of ATP and in a kinesin-dependent manner. Interacts, through a C-terminal domain, with GNAO1. Amyloid beta-42 binds CHRNA7 in hippocampal neurons. Beta-amyloid associates with HADH2. TISSUE SPECIFICITY: different isoforms in different tissues: kidney. brain. liver. hippocampus, substania nigra pars compacta and cerebellum. In the cerebellum, all the isoforms are abundantly expressed in Purkinje cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
A synthetic peptide (HMNVQNGKWESDPSGTKTC, aa: 44-62) as part of mouse APP isoform A conjugated to the immunogenic protein Blue Carrier Protein
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Recommended to be used at a dilution of 1:500 to 1:3000 for immunohistochemistry. This antiserum has not yet been tested for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Amyloid beta A4 protein; ABPP; Alzheimer disease amyloid protein homolog; Amyloidogenic glycoprotein; AG
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specificity for APP was confirmed by IHC. This antiserum is known to react with rat APP. Reactivity with other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Amyloid-beta precursor protein (APP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
FUNCTION: Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1/Tip60 and inhibit Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity. Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. May be involved in copper homeostasis/oxidative stress through copper ion reduction. Can regulate neurite outgrowth through binding to components of the extracellular matrix such as heparin and collagen I and IV. FUNCTION: Beta-amyloid peptides are lipophilic metal chelators with metal-reducing activity. Bind transient metals such as copper, zinc and iron. Rat and mouse beta-amyloid peptides bind only weakly transient metals and have little reducing activity due to substitutions of transient metal chelating residues. Beta-APP42 may activate mononuclear phagocytes in the brain and elicit inflammatory responses. Promotes both tau aggregation and TPK II-mediated phosphorylation (By similarity). FUNCTION: The gamma-CTF peptides as well as the caspase-cleaved peptides, including C31, are potent enhancers of neuronal apoptosis. SUBUNIT: Binds, via its C-terminus, to the PID domain of several cytoplasmic proteins, including APBB family members, the APBA family, MAPK8IP1, SHC1, Numb and Dab1. Binding to Dab1 inhibits its serine phosphorylation. Also interacts with GPCR-like protein BPP, FPRL1, APPBP1, IB1, KNS2 (via its TPR domains), APPBP2 (via BaSS) and DDB1. In vitro, it binds MAPT via the MT-binding domains. Associates with microtubules in the presence of ATP and in a kinesin-dependent manner. Interacts, through a C-terminal domain, with GNAO1. Amyloid beta-42 binds CHRNA7 in hippocampal neurons. Beta-amyloid associates with HADH2. TISSUE SPECIFICITY: different isoforms in different tissues: kidney. brain. liver. hippocampus, substania nigra pars compacta and cerebellum. In the cerebellum, all the isoforms are abundantly expressed in Purkinje cells.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
Synthetic peptides (C-ETHLHW HTVAKET, aa: 145-157; C-HAH FQKAKERLEA KHRER, aa: 388-405; C-KKKQYTS IHHGVVE, aa: 724-737) as parts of human APP isoform A conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. Recommended to be used at a dilution of 1:500 to 1:3000 for immunohistochemistry. This antiserum has not yet been tested for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity for APP was confirmed by IHC. This antiserum is known to react with rat APP. Reactivity with other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
CD325 (N-cadherin) is a type I transmembrane protein, which forms a complex with catenins, that is linked to the actin cytoskeleton. This complex is important in synapses and for functional plasticity of neurons, and is also essential for embryonic development. Decreased CD325 cleavage caused by mutations in presenilin 1 is associated with Alzheimer´s disease. Besides nervous system, CD325 is expressed on the surface of malignant T cells, and increases their adhesion to epithelia, as well as their ability to invade and metastasize to inflammatory sites.
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
bacterially expressed extracellular domain of human CD325
Glycogen synthase kinase 3 (GSK-3), a serine-threonine kinase with two isoforms (alpha and beta), was originally discovered as a key enzyme in glycogen metabolism. GSK-3 was subsequently shown to function in cell division, proliferation, motility and survival. GSK-3 plays a role in a number of pathological conditions including cancer and diabetes and is increasingly seen as an important component of neurological diseases. GSK-3 phosphorylates tau and presenilin-1, which are involved in the development of Alzheimer's disease. Both isoforms of GSK-3 are ubiquitously expressed, although particularly high levels of GSK-3beta are found in the brain where it is involved in synaptic plasticity, possibly via regulation of NMDA receptor trafficking. GSK-3 phosphorylates over 40 different substrates including signaling proteins, transcription factors and structural proteins, and is part of the signal transduction cascade of a large number of growth factors and cytokines. The activity of GSK is regulated by phosphorylation (Akt: Akt-mediated phosphorylation at Ser21 of GSK-3? and Ser9 of GSK-3?, S6K, RSK, PKA and PKC), dephosphorylation (PP1 and PP2A), and by binding to protein complexes (with beta-catenin, axin, CK1 and the APC complex).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
4°C -20°C for long term storage
Host Animal:
mouse
Immunogen:
Purified recombinant fragment of human GSK3B expressed in E. Coli.
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.