The EZ Set Accessory Kit provides an easy way to get all the reagents you need for performing an ELISA assay. The components included in the EZ Set Accessory Kit can also be substituted with products other sources if it is of convenience to you.
s ECL Plus Western Blotting Substrate is an ultra-sensitive, luminol-based chemiluminescent substrate for the detection of horseradish peroxidase (HRP) at high sensitivity levels (low picogram to mid-femtogram). Western Blotting Substrate may be used for immunoblots, western blots, dot blots and any blotting application utilizing horseradish peroxidase (HRP)-conjugates. The substrate can be used with various blocking buffers and on nitrocellulose or PVDF membranes. Such blots will exhibit low backgrounds. Produced chemiluminescence can be visualized on CCD imaging systems or x-ray film.
Product Type:
Assay & Detection
Storage Temp:
Upon receipt store ECL Plus Western Blotting Substrate at 4°C. Protect from light. It is stable at 4°C for one year.
DAPI Stain Solution, IHC Related Reagent, For nucleus restaining in Immunofluorescence experiments
Product Type:
Assay & Detection
Storage Temp:
-20°C
Additional Info:
DAPI (4',6-diamidino-2-phenylindole) is a fluorescent dye which can bind DNA strands robustly, the fluorescence being detected by fluorescence microscope. DAPI can dye both live and fixed cells as it can cross intact membrane, with higher efficiency in fixed cells. The molecular formula is C16H15N5·2HCl with 350.25 g/mol molecular weight, CAS Number 28718-90-3. DAPI could pass through the cell and nucleic membranes and bind the double-strand DNA in the nucleus, producing 20 times stronger fluorescence than itself. The efficiency detected by fluorescence microscope is very high (almost 100%), having no side effects for the live cells. The sensitivity for double stranded DNA DAPI staining is many times larger comparing to ethidium bromide (EB). DAPI staining is usually used in cell death detection, as it enters more effectively and generates stronger fluorescence in dead cells. After staining with DAPI, detect with fluorescence microscope or flow cytometry. Blue fluorescent cell would be seen under the microscope after staining. The largest excitation wavelength for DAPI is 340nm (ultraviolet), and the largest emission wavelength is 488nm (blue). When DAPI binds with double-strand DNA, the largest excitation wavelength is 360nm, while the largest emission wavelength becomes 460nm. DAPI's blue emission makes it suitable for combined assays where the fluorescence ranges of DAPI and other IHC-employed fluorescent molecules like green-fluorescent fluorescein and GFP, or red-fluorescent stains like Texas Red, are completely distinctive.
s Citrate Buffer Pack is an IHC antigen retrieval reagent used in heat induced epitope retrieval (HIER) for recovery of antigens masked by cross-linking during fixation.
Product Type:
Buffers & Mixes
Storage Temp:
Store at room temperature (RT) for one year
Additional Info:
In immunohistochemistry (IHC) the most commonly used fixatives for preserving cell morphology and tissue architecture cause cross-linkages that mask epitopes, leading to poor or no staining. To reverse the loss of antigenicity and enable the primary antibodies to bind antigens, Heat-Induced Epitope Retrieval (HIER) is used to unmask epitopes by breaking the methylene bridges formed during fixation. During the process of HIER the buffer helps unfold the proteins, improving the accessibility of antibodies to tissue antigens. Citrate buffer solution is the preferred antigen retrieval buffer for most antibodies during HIER.
Chinese Hamster BMP-7 ELISA Kit (96 Tests). Quantitate Chinese Bmp7 in bone tissue, cell culture supernatants, serum and plasma (heparin, EDTA). Sensitivity: 10pg/ml.
Product Type:
Assay & Detection
Storage Temp:
Mixed
Immunogen:
Expression system for standard: CHO; Immunogen sequence: S292-H430
Applications:
ELISA
Additional Info:
Sandwich High Sensitivity ELISA kit for Quantitative Detection of Chinese hamster BMP-7. 96wells/kit, with removable strips.
Biosite Brand:
BioSite ELISA
Species Reactivity:
hamster
Cross Reactivity:
There is no detectable cross-reactivity with other relevant proteins.
ReagentsHuman AACT Microplate: A 96-well polystyrene microplate (12 strips of 8 wells) coated with a polyclonal antibody against human AACT.Sealing Tapes: Each kit contains 3 precut, pressure sensitive sealing tapes that can be cut to fit the format of the individual assay.Human AACT Standard: Human AACT in a buffered protein base (288 ng, lyophilized).Biotinylated Human AACT Antibody (50x): A 50-fold biotinylated polyclonal antibody against human AACT (120 ul).EIA Diluent Concentrate (10x): A 10-fold concentrated buffered protein base (30 ml).Wash Buffer Concentrate (20x): A 20-fold concentrated buffered surfactant (30 ml, 2 bottles).Streptavidin-Peroxidase Conjugate (SP Conjugate): A 100-fold concentrate (80 ul).Chromogen Substrate: A ready-to-use stabilized peroxidase chromogen substrate tetramethylbenzidine (8 ml).Stop Solution: A 0.5 N hydrochloric acid to stop the chromogen substrate reaction (12 ml).
Human Adiponectin Quick ELISA Kit (90 minutes, 96 Tests). Quantitate Human ADIPOQ in cell culture supernatants, serum, plasma (heparin, EDTA) and urine. Sensitivity: 60pg/ml.
Product Type:
Assay & Detection
Storage Temp:
Mixed
Immunogen:
Expression system for standard: NS0; Immunogen sequence: E19-N244
Applications:
ELISA
Additional Info:
The Quick ELISA kits, assay takes less than 1.5 hours. Detect Human Adiponectin with <60pg/ml sensitivity Compatible samples: cell culture supernatants, serum, plasma (heparin, EDTA) and urine. This is a TMB colorimetric sandwich ELISA kit with short assay time and quick experiment set up.
Biosite Brand:
BioSite ELISA
Species Reactivity:
human
Cross Reactivity:
There is no detectable cross-reactivity with other relevant proteins.
Human Adiponectin ELISA Kit EZ-Set (DIY Antibody Pairs) (antibody pairs and standards for assay development). Quantitate Human ADIPOQ in cell culture supernatants, serum, plasma (heparin, EDTA) and urine. Sensitivity: 60pg/ml.
Product Type:
Antibodies Primary
Immunogen:
Expression system for standard: NS0; Immunogen sequence: E19-N244
Applications:
ELISA
Biosite Brand:
BioSite ELISA
Species Reactivity:
human
Cross Reactivity:
There is no detectable cross-reactivity with other relevant proteins.
The AssayMax Human Adiponectin ELISA Kit is designed for detection of adiponectin in human urine, plasma, serum and cell culture supernatants. This assay employs a quantitative sandwich enzyme immunoassay technique that measures adiponectin in less than 4 hours. A polyclonal antibody specific for adiponectin has been pre-coated onto a microplate. Adiponectin in standards and samples is sandwiched by the immobilized antibody and biotinylated polyclonal antibody specific for adiponectin, which is recognized by a streptavidin-peroxidase conjugate. All unbound material is then washed away and a peroxidase enzyme substrate is added. The color development is stopped and the intensity of the color is measured. Reagents Adiponectin Microplate: A 96-well polystyrene microplate (12 strips of 8 wells) coated with a polyclonal antibody against human adiponectin. Sealing Tapes: Each kit contains 3 pre-cut, pressure-sensitive sealing tapes, which can be cut to fit the format of the individual assay. Adiponectin Standard: Human adiponectin in a buffered protein base (800 ng, lyophilized). Biotinylated Adiponectin Antibody (100x): A 100-fold concentrated biotinylated polyclonal antibody against adiponectin (80 ?l). MIX Diluent Concentrate (10x): A 10-fold concentrated buffered protein base (30 ml). Wash Buffer Concentrate (20x): A 20-fold concentrated buffered surfactant (30 ml, 2 botlles). Streptavidin-Peroxidase Conjugate (SP Conjugate): A 100-fold concentrate (80 ?l). Chromogen Substrate: A ready-to-use stabilized peroxidase chromogen substrate tetramethylbenzidine (8 ml). Stop Solution: A 0.5 N hydrochloric acid to stop the chromogen substrate reaction (12 ml).
s Broad Spectrum Protease Inhibitor Cocktail (EDTA free) is a complex of various protease inhibitors, which has been tested for inhibiting proteases and esterase broadly.
Product Type:
Chemicals & Biochemicals
Storage Temp:
-20°C
Additional Info:
Bosterâs Broad Spectrum Protease Inhibitor Cocktail (EDTA free) is a complex of various protease inhibitors, which has been tested for inhibiting proteases and esterase broadly.Â
Recombinant protein rDau c 1 is expressed in Escherichia coli. DNA sequence encoding 167 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 17,5 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rCup s 1 is expressed in Escherichia coli. DNA sequence encoding 359 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 39 kDa.
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rCor a 1 is expressed in Escherichia coli. DNA sequence encoding 174 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 19,1 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rCan f 1 is expressed in Escherichia coli. DNA sequence encoding 169 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 18,8 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rBet v 1 is expressed in Escherichia coli. DNA sequence encoding 172 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 19 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rBet v 7 is expressed in Escherichia coli. DNA sequence encoding 186 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 19,7 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA,FC
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rBet v 6 is expressed in Escherichia coli. DNA sequence encoding 320 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 35,5 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rBet v 4 is expressed in Escherichia coli. DNA sequence encoding 97 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 10,8 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA,FC
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rBet v 2 is expressed in Escherichia coli. DNA sequence encoding 152 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 16,2 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA,FC
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
This rat IgG2b kappa monoclonal antibody (clone RTG2B1-2, also known as G2B-1-2 or KLH/G2B-1-2) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2B1-2
Antibody Isotype:
IgG2b
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Clone number:
RTG2B1-2
Antibody Isotype:
IgG2b
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
This rat IgG2b kappa monoclonal antibody (clone RTG2B1-2, also known as G2B-1-2 or KLH/G2B-1-2) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2B1-2
Antibody Isotype:
IgG2b
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This rat IgG2b kappa monoclonal antibody (clone RTG2B1-2, also known as G2B-1-2 or KLH/G2B-1-2) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2B1-2
Antibody Isotype:
IgG2b
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
This rat IgG2a kappa monoclonal antibody (clone RTG2A1-1, also known as G2A-1-1 or KLH/G2A-1-1) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2A1-1
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This rat IgG2a kappa monoclonal antibody (clone RTG2A1-1, also known as G2A-1-1 or KLH/G2A-1-1) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2A1-1
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
This rat IgG2a kappa monoclonal antibody (clone RTG2A1-1, also known as G2A-1-1 or KLH/G2A-1-1) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2A1-1
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Clone number:
RTG2A1-1
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This rat IgG2a kappa monoclonal antibody (clone RTG2A1-1, also known as G2A-1-1 or KLH/G2A-1-1) detects specifically the hemocyanin of keyhole limpet and can be used as a negative control antibody in other species.
Clone number:
RTG2A1-1
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Recombinant protein rAsp f 1 is expressed in Escherichia coli. DNA sequence encoding 150 AAs was fused with His-tag at the N-terminus. A calculated molecular mass of recombinant protein is 17 kDa.
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rAra h 9 is expressed in Escherichia coli. DNA sequence encoding 105 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 10,6 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rAra h 8 is expressed in Escherichia coli. DNA sequence encoding 169 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 18,3 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rAra h 2 is expressed in Escherichia coli. DNA sequence encoding 164 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 19,5 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rAra h 1 is expressed in Escherichia coli. DNA sequence encoding 614 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 70,2 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
ELISA,FC
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rApi m 2 is expressed in S2 cell (Drosophila). DNA sequence encoding 363 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 42,3 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rApi m 1 is expressed in S2 cell (Drosophila). DNA sequence encoding 148 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 16,8 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rApi g 1 is expressed in Escherichia coli. DNA sequence encoding 167 AAs was fused with His-tag at the C-terminus. A calculated molecular mass of recombinant protein is 17,9 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using His-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
Recombinant protein rAmb a 1 is expressed in Escherichia coli. DNA sequence encoding 384 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 41 kDa.
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Recombinant protein rAlt a 1 is expressed in Escherichia coli. DNA sequence encoding 152 AAs was fused with Strep-tag at the N-terminus. A calculated molecular mass of recombinant protein is 16,7 kDa.
Product Type:
Antibodies Primary
Storage Temp:
Store at -20°C to -80°C. Reconstitute in sterile deionized water. Use reconstituted product immediately or aliquot for further storage at -20°C to -80°C.
Applications:
FC,ELISA
Additional Info:
The protein was purified by ionex and affinity chromatography, using Strep-tag. Endotoxin was removed using a specific endotrap carrier. Product was lyophilized after purification.
PDK1 (3-phosphoinositide-dependent kinase 1), also known as PDPK1, is a key mediator of biological responses downstream of insulin and other tyrosine kinase receptors, regulating cell survival, cell cycle control, protein translation, and glucose metabolism. PDK1, containing a C-terminal pleckstrin homology domain, is activated in a phosphatidyl inositol 3,4,5-trisphosphate-dependent manner and phosphorylates multiple signaling molecules, including PKB/Akt, PKC, p70S6 kinase, serum and glucocorticoid-induced kinase. In T cells, nucleation of TCR-induced signaling complex for NFkappaB activation pathway is another crucial role of PDK1. Subcellular localization of PDK1 depends on conditions and has not been completely understood.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
Peptide corresponding to the amino acids CIQEVWRQRYQSHPDAAVQ of human PDK1
Applications:
WB
Additional Info:
The rabbit polyclonal antibody recognizes PDK1, a serine/threonine proteinkinase of 63 kDa, which is a central activator of multiple signaling pathways coupled to a large number of growth-promoting stimuli.
NTAL (non-T cell activation linker), also known as LAB (linker for activation of B cells), is a 30 kDa double-palmitoylated transmembrane adaptor protein expressed by B cells, NK cells, mast cells and macrophages. It is a negative regulator of early stages of BCR-dependent B cell signaling and serves as a negative regulator also in mast cells. However, in mast cells, NTAL also contributes to some activation processes, partially overlapping with LAT function.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant mouse NTAL (aa 30-203).
Applications:
WB,ICC
Additional Info:
The polyclonal antibody reacts with intracellular part of Non-T cell Activation Linker (NTAL), also known as LAB (linker of activated B cells), a 25 kDa transmembrane adaptor protein present in membrane microdomains (rafts) of B cells, NK cells and myeloid cells.
NTAL (non-T cell activation linker), also known as LAB (linker for activation of B cells), is a 30 kDa double-palmitoylated transmembrane adaptor protein expressed by B cells, NK cells, mast cells and macrophages. It is a negative regulator of early stages of BCR-dependent B cell signaling and serves as a negative regulator also in mast cells. However, in mast cells, NTAL also contributes to some activation processes, partially overlapping with LAT function.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant cytoplasmic domain (aa 91-243) of human NTAL.
Applications:
WB,IHC
Additional Info:
The polyclonal antibody recognizes a defined intracellular region (aa 91-243) of human Non-T cell Activation Linker (NTAL), also known as LAB (linker of activated B cells), a 30 kDa transmembrane adaptor protein present in membrane microdomains (rafts) of B cells, NK cells and myeloid cells.
Clone number:
PAb (485)
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml; positive control: RAMOS human lymphoma cell line, THP-1 human monocytic leukemia cell line; negative control: JURKAT human T cell leukemia cell line; non-reducing conditions, 15% separating SDS-PAGE gel. Immunohistochemistry (paraffin sections): Recommended dilution:10 ?g/ml; positive tissue: spleen.
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
NK1.1 / CD161bc (also known as NKRP1, Ly55c, or Ly59) is a cell surface antigen expressed on NK cells and NK-T cells of certain mouse strains, which is being used for identification or antibody-mediated depletion of these cells in the respective strains. This antigen participates in NK cell activation, including production of interferon gamma, and release of cytotoxic granules.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
NK1-positive murine splenic and bone marrow cells
Applications:
FC,IP,IHC,FA
Additional Info:
The mouse monoclonal antibody PK136 recognizes NK1.1 antigen (NK cell marker) expressed by some mouse strains (e.g. C57BL/6, NZB, CE, C58, Ma/My), whereas other strains (e.g. BALB/c, AKR, CBA, C3H) do not express this antigen. This antibody detects a conformational epitope on Nkrp1c and Nkrp1b gene products.
MRCK alpha (myotonic dystrophy kinase-related Cdc42-binding kinase alpha) is a member of the dystrophia myotonica protein kinase (DMPK) family that functions downstream of Cdc42 in actin cytoskeletal reorganization. It is a serine/threonine kinase with multiple functional domains, including phorbol ester-responsive C1 domain. Three independent coiled-coil domains and the N-terminal region preceding the kinase domain are responsible for intermolecular interactions leading to MRCK alpha multimerization. The transautophosphorylation process is critical for regulation of MRCK alpha catalytic activities. Binding of phorbol esters to MRCK releases its autoinhibition, allowing N-terminal dimerization and subsequent kinase activation.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
a peptide of RDFDGEDSDSPRHST sequence
Applications:
WB,ICC
Additional Info:
The polyclonal antibody anti-MRCK alpha recognizes myotonic dystrophy kinase-related Cdc42-binding kinase alpha (intracellular), a 180 kDa Ser/Thr kinase, which is responsible for reorganization of actin cytoskeleton.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PFR-03, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgM molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgM monoclonal antibody (clone PFR-03) reacts with undefined epitope on a plant pathogen.
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PFR-03, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgM molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Applications:
FC
Additional Info:
This mouse IgM monoclonal antibody (clone PFR-03) reacts with undefined epitope on a plant pathogen.
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PFR-03, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgM molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgM monoclonal antibody (clone PFR-03) reacts with undefined epitope on a plant pathogen.
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgM monoclonal antibody (clone PFR-03) reacts with undefined epitope on a plant pathogen.
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgM monoclonal antibody (clone PFR-03) reacts with undefined epitope on a plant pathogen.
Clone number:
PFR-03
Antibody Isotype:
IgM
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PPV-07, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG3 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgG3 monoclonal antibody (clone PPV-07) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-07
Antibody Isotype:
IgG3
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Clone number:
PPV-07
Antibody Isotype:
IgG3
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG3 monoclonal antibody (clone PPV-07) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-07
Antibody Isotype:
IgG3
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG3 monoclonal antibody (clone PPV-07) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-07
Antibody Isotype:
IgG3
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PLRV219, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgG2b monoclonal antibody (clone PLRV219) reacts with undefined epitope on a plant pathogen.
Clone number:
PLRV219
Antibody Isotype:
IgG2b
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
ELISA,FC,IP,WB,IHC,ICC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
WB,ELISA,ICC,IHC,IP,FC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MPC-11 was generated against an epitope irrelevant for human, mouse, and rat material, and can thus be used for evaluation of the background staining that is caused by general nonspecific interactions between an mouse IgG2b molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
KLH-coupled trinitrophenol
Applications:
FC
Additional Info:
This mouse IgG2b (kappa) monoclonal antibody (clone MPC-11) reacts with an epitope irrelevant for a variety of resting, activated, live, and fixed human, mouse, and rat tissues.
Clone number:
MPC-11
Antibody Isotype:
IgG2b k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC,IP,WB,ICC,IHC,ELISA,FA
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PPV-04, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA,FA
Additional Info:
This mouse IgG2a monoclonal antibody (clone PPV-04) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-04
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PPV-04, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgG2a monoclonal antibody (clone PPV-04) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-04
Antibody Isotype:
IgG2a
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC,ICC,WB,IP,IHC,ELISA
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-173, generated against an undefined antigen, does not react specifically with mouse, rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG2a molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
The transplantable plasmacytoma MOPC-173 was induced by intraperitoneal injection of mineral oils into BALB/c mice.
Applications:
FC
Additional Info:
This mouse IgG2a monoclonal antibody (clone MOPC-173) reacts with an unknown epitope. It does not react with a variety of resting, activated, live, and fixed mouse, rat and human tissues.
Clone number:
MOPC-173
Antibody Isotype:
IgG2a k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,WB,IHC,ICC,ELISA,FA
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,WB,IHC,ICC,ELISA
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody PPV-06, generated against a plant pathogen, does not cross-react with other species, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IP,IHC,ICC,WB,ELISA
Additional Info:
This mouse IgG1 monoclonal antibody (clone PPV-06) reacts with undefined epitope on a plant pathogen.
Clone number:
PPV-06
Antibody Isotype:
IgG1
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC,IHC,ICC,WB
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
WB,ELISA,IHC,ICC,IP,FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The specificity of staining by monoclonal antibodies to target antigens should be verified by establishing the amount of non-specific antibody binding. Especially at higher concentration (more than 15 ?g/ml) the antibody staining usually has consignable background. To this end a non-reactive immunoglobulin of the same isotype is included as a negative control for each specific monoclonal antibody used in a particular immunoassay. The monoclonal antibody MOPC-21, generated against an undefined antigen, does not react specifically with rat and human samples, and hence all the background that could be observed when working with this antibody would be a result of general nonspecific interactions between an mouse IgG1 molecule and the respective sample under the particular conditions. This shall help the customer to set up the experimental conditions so that the nonspecific binding of any antibody is abolished.
Product Type:
Antibodies Isotype Control
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
This mouse IgG1 kappa monoclonal antibody (clone MOPC-21) with unknown specificity has been confirmed as a good negative control with human and rat species, based on multiple testing on rat and human tissues.
Clone number:
MOPC-21
Antibody Isotype:
IgG1 k
Application Details:
Negative control: The reagent is intended as an isotype control to establish the amount of non-specific antibody binding. For your particular experiment, use the same concentration of this control antibody as the recommended working concentration of the antigen-specific antibody. Also, when working with prediluted antibodies, dilute the isotype control to the same concentration as is the concentration of the antigen-specific antibody in the prediluted antibody solution you are using. If under particular experimental conditions the background signal of the isotype control is too high (usually when working concentrations of used antibodies are above 10 ?g/ml of incubation mixture), change the conditions of your experiment to reduce the background.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human interferon gamma
Applications:
IP,ELISA,RIA,FA
Additional Info:
The mouse monoclonal antibody NIB42 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
NIB42
Antibody Isotype:
IgG1
Application Details:
Functional application: Neutralization. ELISA: Capture antibody in combination with detection antibody 4S.B3.
The antibody 4H84 recognizes HLA-G molecule (39 kDa). HLA-G belongs to the MHC Class I molecules (MHC Class Ib; nonclassical) and it is expressed on the surface of trophoblast cells.<br> <i>This product is for research and in vitro experimental use only. It is not to be used for any other commercial purpose. Use of this product to produce products for sale or for therapeutic or drug discovery purposes is prohibited. In order to obtain a license to use this product for commercial purposes, contact The Regents of the Univessity of California.</i>
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
amino acids 61-83 of HLA-G of human origin
Applications:
WB,IP,IHC,ICC,ELISA
Additional Info:
The antibody 4H84 recognizes HLA-G molecule (39 kDa). HLA-G belongs to the MHC Class I molecules (MHC Class Ib; nonclassical) and it is expressed on the surface of trophoblast cells.<br>_x000D_ <i>This product is for research and in vitro experimental use only. It is not to be used for any other commercial purpose. Use of this product to produce products for sale or for therapeutic or drug discovery purposes is prohibited. In order to obtain a license to use this product for commercial purposes, contact The Regents of the Univesity of California.</i>_x000D_ _x000D_
The antibody 4H84 recognizes HLA-G molecule (39 kDa). HLA-G belongs to the MHC Class I molecules (MHC Class Ib; nonclassical) and it is expressed on the surface of trophoblast cells.<br> <i>This product is for research and in vitro experimental use only. It is not to be used for any other commercial purpose. Use of this product to produce products for sale or for therapeutic or drug discovery purposes is prohibited. In order to obtain a license to use this product for commercial purposes, contact The Regents of the Univessity of California.</i>
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
amino acids 61-83 of HLA-G of human origin
Applications:
WB,IP,IHC,ICC,ELISA
Additional Info:
The antibody 4H84 recognizes HLA-G molecule (39 kDa). HLA-G belongs to the MHC Class I molecules (MHC Class Ib; nonclassical) and it is expressed on the surface of trophoblast cells.<br>_x000D_ <i>This product is for research and in vitro experimental use only. It is not to be used for any other commercial purpose. Use of this product to produce products for sale or for therapeutic or drug discovery purposes is prohibited. In order to obtain a license to use this product for commercial purposes, contact The Regents of the Univesity of California.</i>_x000D_ _x000D_
The HIV protease (PR) hydrolyzes polyproteins of HIV virus into functional protein products that are essential for its assembly and subsequent activity. This maturation process occurs as the virion buds from the host cell. HIV protease inhibitors are used in the treatment of patients with AIDS and were considered the first breakthrough in over a decade of AIDS research. HIV protease inhibitors can lower the viral load carried by AIDS patents. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Bacterially expressed full-length HIV-1 protease
Applications:
WB,ELISA,FA
Additional Info:
The antibody 1696 recognizes free N-terminus of mature HIV protease (HIV-1 and HIV-2), an enzyme that hydrolyzes polyproteins of HIV viruses into functional proteins. <br>The antibody 1696 does not react with the precursor.
GABA B receptor is a G-protein-coupled inhibitory receptor of gamma-aminobutyric acid (GABA), and has important functions in brain by inhibition of adenylyl cyclase and modulation of G-protein-gated Ca2+ and K+ channels. GABA B receptor is comprised of two subunits, GB1 and GB2 with N-terminal extracellular and C-terminal intracellular domains. The GB1 subunit plays a critical role in ligand binding, whereas the GB2 subunit contains the determinants required for G-protein signaling. Multiple allosteric interactions between the two subunits are required for correct functioning of the receptor. There are two N-terminal splice variants of GB1 subunit, termed GB1a and GB1b; their expression in the central nervous system changes during the ontogenesis and differs between various regions of the brain.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
Synthetic peptide (coupled with THG) derived from amino acid sequence 30-47 of mouse GABA B receptor 1b. Only 1 amino acid is different from immunogen derived from human GB1b.
Applications:
WB,ICC
Additional Info:
The polyclonal antibody recognizes N-terminus of mouse gamma-aminobutyric acid (GABA) B receptor 1b. GB1b apparent MW ~100 kDa._x000D_ _x000D_
CD95 (Fas, APO-1), a 46 kDa transmembrane glycoprotein, is a cell death receptor of the TNFR superfamily. Stimulation of CD95 results in aggregation of its intracellular death domains, formation of the death-inducing signaling complex (DISC) and activation of caspases. In type I cells caspase 3 is activated by high amounts of caspase 8 generated at the DISC, in type II cells low concentration of caspase 8 activates pathway leading to the release of cytochrome c from mitochondria and activation of caspase 3 by cytochom c. Besides its roles in induction of apoptosis, Fas also triggers pro-inflammatory cytokine responses.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
HUT-78 human T cell lymphoma cells
Applications:
FC,FA
Additional Info:
The antibody UT-1 reacts with an extracellular epitope on CD95 (Fas/APO-1), a 46 kDa glycoprotein of the tumour necrosis factor/nerve growth factor (TNF/NGF) receptor superfamily, expressed on a variety of normal and neoplastic cells. The antibody UT-1 does excellently induce Fas mediated apoptosis, similarly as CH11 antibody.
CD79b (Ig beta, B29) forms disulfide-linked heterodimer with CD79a (Ig alpha, MB1). They both are transmembrane proteins with extended cytoplasmic domains containing immunoreceptor tyrosine activation motives (ITAMs), and together with cell surface immunoglobulin they constitute B-cell antigen-specific receptor (BCR). CD79a and b are the first components of BCR that are expressed developmentally. They appear on pro-B cells in association with the endoplasmic reticulum chaperone calnexin. Subsequently, in pre-B cells, CD79 heterodimer is associated with lambda5-VpreB surrogate immunoglobulin and later with antigen-specific surface immunoglobulins. CD79a/b complex interacts with Src-family tyrosine kinase Lyn, which phosphorylates its cytoplasmic ITAM motives to form docking sites for downstream signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Purified CD79a/b (alpha/beta) dimers from WEHI231 cells_x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster monoclonal antibody HM79 recognizes an extracellular epitope of mouse CD79b (CD79 beta, Ig beta), a component of B cell receptor (BCR) complex._x000D_
CD79b (Ig beta, B29) forms disulfide-linked heterodimer with CD79a (Ig alpha, MB1). They both are transmembrane proteins with extended cytoplasmic domains containing immunoreceptor tyrosine activation motives (ITAMs), and together with cell surface immunoglobulin they constitute B-cell antigen-specific receptor (BCR). CD79a and b are the first components of BCR that are expressed developmentally. They appear on pro-B cells in association with the endoplasmic reticulum chaperone calnexin. Subsequently, in pre-B cells, CD79 heterodimer is associated with lambda5-VpreB surrogate immunoglobulin and later with antigen-specific surface immunoglobulins. CD79a/b complex interacts with Src-family tyrosine kinase Lyn, which phosphorylates its cytoplasmic ITAM motives to form docking sites for downstream signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Purified CD79a/b (alpha/beta) dimers from WEHI231 cells_x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster monoclonal antibody HM79 recognizes an extracellular epitope of mouse CD79b (CD79 beta, Ig beta), a component of B cell receptor (BCR) complex._x000D_
CD79b (Ig beta, B29) forms disulfide-linked heterodimer with CD79a (Ig alpha, MB1). They both are transmembrane proteins with extended cytoplasmic domains containing immunoreceptor tyrosine activation motives (ITAMs), and together with cell surface immunoglobulin they constitute B-cell antigen-specific receptor (BCR). CD79a and b are the first components of BCR that are expressed developmentally. They appear on pro-B cells in association with the endoplasmic reticulum chaperone calnexin. Subsequently, in pre-B cells, CD79 heterodimer is associated with lambda5-VpreB surrogate immunoglobulin and later with antigen-specific surface immunoglobulins. CD79a/b complex interacts with Src-family tyrosine kinase Lyn, which phosphorylates its cytoplasmic ITAM motives to form docking sites for downstream signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Purified CD79a/b (alpha/beta) dimers from WEHI231 cells_x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster monoclonal antibody HM79 recognizes an extracellular epitope of mouse CD79b (CD79 beta, Ig beta), a component of B cell receptor (BCR) complex._x000D_
The CD66 molecules are 180-200 kDa glycoproteins of carcinoembryonic antigen family. They are present on all blood granulocytes and some tissue macrophages, but are absent from other hematopoietic cells. The expression of CD66 increases significantly on granulocytes upon their activation. CD66a (BGP1, CEACAM1) and CD66d (CGM1, CEACAM3), as well as CEACAM2 and 4, are transmembrane proteins, whereas CD66c (CEAL, NCA, CEACAM6) and CD66e (CEA, CEACAM5), as well as CEACAM7 and 8, are anchored to the plasma membrane by C-terminal glycosylphosphatidylinositol (GPI) lipid moiety.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Human granulocytes
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody CLB-gran/10 (IH4Fc) detects human CD66acde antigen, a granulocyte marker, especially after cell stimulation. The antibody does not cross-react with normal human peripheral B cells, T cells, monocytes and platelets. Weak reactivity has been observed with malignant cells of pacients with B cell-derived CLL. In immunohistochemistry the antibody reacts with some tissue macrophages and carcinoma-expressed CEA. <br>_x000D_ <b>HLDA IV; WS Code M38</b>
CD54 (ICAM-1) is a member of the C2 subset of immunoglobulin superfamily. It is a transmembrane molecule with 7 potential N-glycosylated sites, expressed on resting monocytes and endothelial cells and can be upregulated on many other cells, e.g. with lymphokines, on B- and T-lymphocytes, thymocytes, dendritic cells and also on keratinocytes, chondrocytes, as well as epithelial cells. CD54 mediates cell adhesion by binding to integrins CD11a/CD18 (LFA-1) and to CD11b/CD18 (Mac-1). The interaction of CD54 with LFA-1 enhances antigen-specific T-cell activation. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Mouse NS-1 cells_x000D_
Applications:
FC,IP,WB,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody YN1/1.7.4 reacts with CD54 (ICAM-1), a 85-110 kDa type I transmembrane glycoprotein expressed on activated endothelial cells, T lymphocytes, B lymphocytes, monocytes, macrophages, granulocytes and dendritic cells; the expression of CD54 is upregulated by activation. _x000D_
CD54 (ICAM-1) is a member of the C2 subset of immunoglobulin superfamily. It is a transmembrane molecule with 7 potential N-glycosylated sites, expressed on resting monocytes and endothelial cells and can be upregulated on many other cells, e.g. with lymphokines, on B- and T-lymphocytes, thymocytes, dendritic cells and also on keratinocytes, chondrocytes, as well as epithelial cells. CD54 mediates cell adhesion by binding to integrins CD11a/CD18 (LFA-1) and to CD11b/CD18 (Mac-1). The interaction of CD54 with LFA-1 enhances antigen-specific T-cell activation. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Mouse NS-1 cells_x000D_
Applications:
FC,IP,WB,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody YN1/1.7.4 reacts with CD54 (ICAM-1), a 85-110 kDa type I transmembrane glycoprotein expressed on activated endothelial cells, T lymphocytes, B lymphocytes, monocytes, macrophages, granulocytes and dendritic cells; the expression of CD54 is upregulated by activation. _x000D_
CD54 (ICAM-1) is a member of the C2 subset of immunoglobulin superfamily. It is a transmembrane molecule with 7 potential N-glycosylated sites, expressed on resting monocytes and endothelial cells and can be upregulated on many other cells, e.g. with lymphokines, on B- and T-lymphocytes, thymocytes, dendritic cells and also on keratinocytes, chondrocytes, as well as epithelial cells. CD54 mediates cell adhesion by binding to integrins CD11a/CD18 (LFA-1) and to CD11b/CD18 (Mac-1). The interaction of CD54 with LFA-1 enhances antigen-specific T-cell activation. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Mouse NS-1 cells_x000D_
Applications:
FC,IP,WB,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody YN1/1.7.4 reacts with CD54 (ICAM-1), a 85-110 kDa type I transmembrane glycoprotein expressed on activated endothelial cells, T lymphocytes, B lymphocytes, monocytes, macrophages, granulocytes and dendritic cells; the expression of CD54 is upregulated by activation. _x000D_
CD44 is a transmembrane glycoprotein expressed on the surface of most cells, which serves as a receptor for hyaluronan. CD44 mediates angiogenesis, cell adhesion, proliferation and migration, it is thus important for lymphocyte activation, recirculation and homing. Although CD44 functions are essential for physiological activities of normal cells, elevated CD44 expression correlates with poor prognosis in many carcinomas, facilitating tumour growth and metastasis, antiapoptosis and directional motility of cancer cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Dexamethasone-induced cells of the SJL mouse spontaneous myeloid leukemia M1_x000D_
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The rat monoclonal antibody IM7 reacts with CD44 antigen (Phagocyte glycoprotein 1), an 80-95 kDa transmembrane glycoprotein (hyaladherin family) present on the most of cells and tissues (leukocytes, endothelial cells, mesenchymal cells, etc.); it is negative on platelets and hepatocytes. The antibody reacts with all isoforms of mouse CD44._x000D_
CD44 is a transmembrane glycoprotein expressed on the surface of most cells, which serves as a receptor for hyaluronan. CD44 mediates angiogenesis, cell adhesion, proliferation and migration, it is thus important for lymphocyte activation, recirculation and homing. Although CD44 functions are essential for physiological activities of normal cells, elevated CD44 expression correlates with poor prognosis in many carcinomas, facilitating tumour growth and metastasis, antiapoptosis and directional motility of cancer cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Dexamethasone-induced cells of the SJL mouse spontaneous myeloid leukemia M1_x000D_
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The rat monoclonal antibody IM7 reacts with CD44 antigen (Phagocyte glycoprotein 1), an 80-95 kDa transmembrane glycoprotein (hyaladherin family) present on the most of cells and tissues (leukocytes, endothelial cells, mesenchymal cells, etc.); it is negative on platelets and hepatocytes. The antibody reacts with all isoforms of mouse CD44._x000D_
CD44 is a transmembrane glycoprotein expressed on the surface of most cells, which serves as a receptor for hyaluronan. CD44 mediates angiogenesis, cell adhesion, proliferation and migration, it is thus important for lymphocyte activation, recirculation and homing. Although CD44 functions are essential for physiological activities of normal cells, elevated CD44 expression correlates with poor prognosis in many carcinomas, facilitating tumour growth and metastasis, antiapoptosis and directional motility of cancer cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Dexamethasone-induced cells of the SJL mouse spontaneous myeloid leukemia M1_x000D_
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The rat monoclonal antibody IM7 reacts with CD44 antigen (Phagocyte glycoprotein 1), an 80-95 kDa transmembrane glycoprotein (hyaladherin family) present on the most of cells and tissues (leukocytes, endothelial cells, mesenchymal cells, etc.); it is negative on platelets and hepatocytes. The antibody reacts with all isoforms of mouse CD44._x000D_
CD44 is a transmembrane glycoprotein expressed on the surface of most cells, which serves as a receptor for hyaluronan. CD44 mediates angiogenesis, cell adhesion, proliferation and migration, it is thus important for lymphocyte activation, recirculation and homing. Although CD44 functions are essential for physiological activities of normal cells, elevated CD44 expression correlates with poor prognosis in many carcinomas, facilitating tumour growth and metastasis, antiapoptosis and directional motility of cancer cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Dexamethasone-induced cells of the SJL mouse spontaneous myeloid leukemia M1_x000D_
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The rat monoclonal antibody IM7 reacts with CD44 antigen (Phagocyte glycoprotein 1), an 80-95 kDa transmembrane glycoprotein (hyaladherin family) present on the most of cells and tissues (leukocytes, endothelial cells, mesenchymal cells, etc.); it is negative on platelets and hepatocytes. The antibody reacts with all isoforms of mouse CD44._x000D_
CD44 is a transmembrane glycoprotein expressed on the surface of most cells, which serves as a receptor for hyaluronan. CD44 mediates angiogenesis, cell adhesion, proliferation and migration, it is thus important for lymphocyte activation, recirculation and homing. Although CD44 functions are essential for physiological activities of normal cells, elevated CD44 expression correlates with poor prognosis in many carcinomas, facilitating tumour growth and metastasis, antiapoptosis and directional motility of cancer cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Dexamethasone-induced cells of the SJL mouse spontaneous myeloid leukemia M1_x000D_
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The rat monoclonal antibody IM7 reacts with CD44 antigen (Phagocyte glycoprotein 1), an 80-95 kDa transmembrane glycoprotein (hyaladherin family) present on the most of cells and tissues (leukocytes, endothelial cells, mesenchymal cells, etc.); it is negative on platelets and hepatocytes. The antibody reacts with all isoforms of mouse CD44._x000D_
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), Human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
Human thymocytes and T lymphocytes.
Applications:
FC,IP,FA
Additional Info:
The antibody MEM-115 recognizes an extracellular epitope in the D1 domain of CD4 antigen, a 55 kDa transmebrane glycoprotein expressed on a subset of T lymphocytes (helper T cells) and also on monocytes, tissue macrophages and granulocytes. It is negative in Western blotting even with non-reduced samples of cell lysates.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta (CD247). These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Synthetic peptide corresponding to amino acids 151-164 of mouse CD3 zeta. _x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster antibody H146-968 reacts with CD3 zeta chain (CD247), which is a component of TCR/CD3 complex expressed on T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta (CD247). These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Synthetic peptide corresponding to amino acids 151-164 of mouse CD3 zeta. _x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster antibody H146-968 reacts with CD3 zeta chain (CD247), which is a component of TCR/CD3 complex expressed on T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta (CD247). These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Synthetic peptide corresponding to amino acids 151-164 of mouse CD3 zeta. _x000D_
Applications:
FC,IP,WB,ICC
Additional Info:
The Armenian hamster antibody H146-968 reacts with CD3 zeta chain (CD247), which is a component of TCR/CD3 complex expressed on T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation._x000D_ The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody SK7 recognizes the CD3 antigen of the TCR/CD3 complex on mature human T cells. This antibody reacts with the epsilon chain of the CD3 complex. The monoclonal antibodies SK7 and UCHT1 recognize overlapping epitopes._x000D_ <br><b>HLDA II; WS Code T118<br>_x000D_ HLDA III; WS Code T492</b>
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation._x000D_ The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody SK7 recognizes the CD3 antigen of the TCR/CD3 complex on mature human T cells. This antibody reacts with the epsilon chain of the CD3 complex. The monoclonal antibodies SK7 and UCHT1 recognize overlapping epitopes._x000D_ <br><b>HLDA II; WS Code T118<br>_x000D_ HLDA III; WS Code T492</b>
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation._x000D_ The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody SK7 recognizes the CD3 antigen of the TCR/CD3 complex on mature human T cells. This antibody reacts with the epsilon chain of the CD3 complex. The monoclonal antibodies SK7 and UCHT1 recognize overlapping epitopes._x000D_ <br><b>HLDA II; WS Code T118<br>_x000D_ HLDA III; WS Code T492</b>
CD28 is the critical T cell costimulatory receptor which provides to the cell the important second activation signal by binding CD80 and CD86 that are expressed by antigen presenting cells. Besides its costimulation role CD28 functions in preventing T cells from anergic hyporesponsive state or from undergoing premature apoptotic cell death. In murine peripheral lymphoid organs and in the blood, all CD4+ and CD8+ T cells express CD28. In the thymus, CD28 expression is highest on immature CD3-, CD8+ and CD4+8+ cells, and on CD4-8- cells that express alpha/beta and gamma/delta TCR. The level of CD28 on mature CD4+ and CD8+ alpha/beta TCR+ thymocytes is two- to fourfold lower than on the immature cells._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Mouse T cell lymphoma EL-4 cells_x000D_
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The Syrian hamster monoclonal antibody 37.51 reacts with extracellular domain of mouse CD28 costimulatory receptor, a 45 kDa homodimeric protein expressed by thymocytes, mature T cells and NK cells._x000D_
TRAIL-R3 (CD263, TR3, DcR1, LIT, TRID), expressed mainly on neutrophils, belongs to receptors of TRAIL, a TNF-like membrane cytotoxic protein that induces apoptosis in many tumour cells, but not in normal cells. TRAIL-R3, however, is a GPI-anchored protein that lacks cytoplasmic death domain, thus it is unable to induce apoptosis and serves as a negative regulator of apoptotic signaling by competing for binding of TRAIL with death receptor 5 (DR5).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
TRAIL-R3 (aa 1-280) - hIgGhc fusion protein
Applications:
FC
Additional Info:
The antibody TRAIL-R3-02 reacts with TRAIL-R3, a 35 kDa GPI-anchored extracellular membrane protein expressed mainly on neutrophils.
TRAIL-R2 (CD262, DR5) is one of two TNF superfamily member intracellular death domain containing receptors for TRAIL (APO2L). Apoptosis, or programmed cell death, occurs during normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by certain cytokines including tumor necrosis factor (TNF) and Fas ligand in the TNF family through their death domain containing receptors, TNF receptor 1 (TNFR1) and Fas, respectively. Another member in the TNF family has been identified and designated TRAIL (for TNF related apoptosis inducing ligand) and Apo2L (for Apo2 ligand). Receptors for TRAIL include two death domain containing receptors, DR4 and DR5, as well as two decoy receptors, DcR1 and DcR2, lacking the intracellular signaling death domain. DcR1 (also called TRID), like the related death receptors DR4 and DR5, contains two extracellular cysteine rich domains. However, DcR1 contains no intracellular death domain and is thus incapable of signaling apoptosis. It has been suggested DcR1 is responsible for TRAIL resistance in normal human tissues including heart, placenta, lung, liver, kidney, spleen, and bone marrow. DR5 is a member of the TNF receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor related apoptosis inducing ligand (TNFSF10/TRAIL/APO2L), and transduces apoptosis signal. Studies with FADD deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Recombinant fusion protein of human IgG heavy chain and extracellular domain of DR5.
Applications:
FC
Additional Info:
The antibody DR5-01-1 recognizes an extracellular domain of TRAIL-R2 (DR5). TRAIL-R2 is one of two TNF superfamily member intracellular death domain containing receptors for TRAIL (APO2L). _x000D_ _x000D_
CD25 (IL2Ralpha, Tac) is a ligand-binding alpha subunit of interleukin 2 receptor (IL2R). Together with beta and gamma subunit CD25 constitues the high affinity IL2R, whereas CD25 alone serves as the low affinity IL2R. CD25 expression rapidly increases upon T cell activation. The 55 kDa CD25 molecule is enzymatically cleaved and shed from the cell surface as a soluble 45 kDa s-Tac, whose concentration in serum can be used as a marker of T cell activation. Expression of CD25 indicates the neoplastic phenotype of mast cells. CD25+ CD4+ FoxP3+ regulatory cells (Treg cells) play a crucial role in the control of organ-specific autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
B6.1 CTL cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody PC61.5 (PC61.5.3) recognizes CD25 (Interleukin-2 receptor alpha chain), a 55 kDa type I transmembrane glycoprotein expressed on activated B and T lymphocytes, activated monocytes/macrophages and on CD4<sup>+</sup> T lymphocytes (T regulatory cells); it is lost on resting B and T lymphocytes.
CD25 (IL2Ralpha, Tac) is a ligand-binding alpha subunit of interleukin 2 receptor (IL2R). Together with beta and gamma subunit CD25 constitues the high affinity IL2R, whereas CD25 alone serves as the low affinity IL2R. CD25 expression rapidly increases upon T cell activation. The 55 kDa CD25 molecule is enzymatically cleaved and shed from the cell surface as a soluble 45 kDa s-Tac, whose concentration in serum can be used as a marker of T cell activation. Expression of CD25 indicates the neoplastic phenotype of mast cells. CD25+ CD4+ FoxP3+ regulatory cells (Treg cells) play a crucial role in the control of organ-specific autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
B6.1 CTL cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody PC61.5 (PC61.5.3) recognizes CD25 (Interleukin-2 receptor alpha chain), a 55 kDa type I transmembrane glycoprotein expressed on activated B and T lymphocytes, activated monocytes/macrophages and on CD4<sup>+</sup> T lymphocytes (T regulatory cells); it is lost on resting B and T lymphocytes.
CD25 (IL2Ralpha, Tac) is a ligand-binding alpha subunit of interleukin 2 receptor (IL2R). Together with beta and gamma subunit CD25 constitues the high affinity IL2R, whereas CD25 alone serves as the low affinity IL2R. CD25 expression rapidly increases upon T cell activation. The 55 kDa CD25 molecule is enzymatically cleaved and shed from the cell surface as a soluble 45 kDa s-Tac, whose concentration in serum can be used as a marker of T cell activation. Expression of CD25 indicates the neoplastic phenotype of mast cells. CD25+ CD4+ FoxP3+ regulatory cells (Treg cells) play a crucial role in the control of organ-specific autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
B6.1 CTL cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody PC61.5 (PC61.5.3) recognizes CD25 (Interleukin-2 receptor alpha chain), a 55 kDa type I transmembrane glycoprotein expressed on activated B and T lymphocytes, activated monocytes/macrophages and on CD4<sup>+</sup> T lymphocytes (T regulatory cells); it is lost on resting B and T lymphocytes.
CD25 (IL2Ralpha, Tac) is a ligand-binding alpha subunit of interleukin 2 receptor (IL2R). Together with beta and gamma subunit CD25 constitues the high affinity IL2R, whereas CD25 alone serves as the low affinity IL2R. CD25 expression rapidly increases upon T cell activation. The 55 kDa CD25 molecule is enzymatically cleaved and shed from the cell surface as a soluble 45 kDa s-Tac, whose concentration in serum can be used as a marker of T cell activation. Expression of CD25 indicates the neoplastic phenotype of mast cells. CD25+ CD4+ FoxP3+ regulatory cells (Treg cells) play a crucial role in the control of organ-specific autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
B6.1 CTL cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody PC61.5 (PC61.5.3) recognizes CD25 (Interleukin-2 receptor alpha chain), a 55 kDa type I transmembrane glycoprotein expressed on activated B and T lymphocytes, activated monocytes/macrophages and on CD4<sup>+</sup> T lymphocytes (T regulatory cells); it is lost on resting B and T lymphocytes.
CD25 (IL2Ralpha, Tac) is a ligand-binding alpha subunit of interleukin 2 receptor (IL2R). Together with beta and gamma subunit CD25 constitues the high affinity IL2R, whereas CD25 alone serves as the low affinity IL2R. CD25 expression rapidly increases upon T cell activation. The 55 kDa CD25 molecule is enzymatically cleaved and shed from the cell surface as a soluble 45 kDa s-Tac, whose concentration in serum can be used as a marker of T cell activation. Expression of CD25 indicates the neoplastic phenotype of mast cells. CD25+ CD4+ FoxP3+ regulatory cells (Treg cells) play a crucial role in the control of organ-specific autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
B6.1 CTL cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody PC61.5 (PC61.5.3) recognizes CD25 (Interleukin-2 receptor alpha chain), a 55 kDa type I transmembrane glycoprotein expressed on activated B and T lymphocytes, activated monocytes/macrophages and on CD4<sup>+</sup> T lymphocytes (T regulatory cells); it is lost on resting B and T lymphocytes.
CD23 (Fc epsilon RII), the low affinity IgE receptor, is a 45 kDa type II membrane glycoprotein expressed more or less on eosinophils, follicular dendritic cells, Langerhans cells, mature B cells (mainly upon activation), EBV-transformed lymphoblasts, monocytes, and subpopulation of platelets. A soluble form of 37 kDa and other its fragments were also described. CD23 mediates IgE-dependent cytotoxicity by eosinophils and macrophages, and downregulates IgE secretion in response to high levels of IgE, involving release of pro-inflammatory cytokines.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
EBV-transformed human cells
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody EBVCS-5 recognizes an epitope located in the stalk region of human low affinity IgE receptor (CD23) between the 37 and 25 kDa cleavage sites.
CD23 (Fc epsilon RII), the low affinity IgE receptor, is a 45 kDa type II membrane glycoprotein expressed more or less on eosinophils, follicular dendritic cells, Langerhans cells, mature B cells (mainly upon activation), EBV-transformed lymphoblasts, monocytes, and subpopulation of platelets. A soluble form of 37 kDa and other its fragments were also described. CD23 mediates IgE-dependent cytotoxicity by eosinophils and macrophages, and downregulates IgE secretion in response to high levels of IgE, involving release of pro-inflammatory cytokines.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
EBV-transformed human cells
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody EBVCS-5 recognizes an epitope located in the stalk region of human low affinity IgE receptor (CD23) between the 37 and 25 kDa cleavage sites.
CD23 (Fc epsilon RII), the low affinity IgE receptor, is a 45 kDa type II membrane glycoprotein expressed more or less on eosinophils, follicular dendritic cells, Langerhans cells, mature B cells (mainly upon activation), EBV-transformed lymphoblasts, monocytes, and subpopulation of platelets. A soluble form of 37 kDa and other its fragments were also described. CD23 mediates IgE-dependent cytotoxicity by eosinophils and macrophages, and downregulates IgE secretion in response to high levels of IgE, involving release of pro-inflammatory cytokines.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
EBV-transformed human cells
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody EBVCS-5 recognizes an epitope located in the stalk region of human low affinity IgE receptor (CD23) between the 37 and 25 kDa cleavage sites.
CD23 (Fc epsilon RII), the low affinity IgE receptor, is a 45 kDa type II membrane glycoprotein expressed more or less on eosinophils, follicular dendritic cells, Langerhans cells, mature B cells (mainly upon activation), EBV-transformed lymphoblasts, monocytes, and subpopulation of platelets. A soluble form of 37 kDa and other its fragments were also described. CD23 mediates IgE-dependent cytotoxicity by eosinophils and macrophages, and downregulates IgE secretion in response to high levels of IgE, involving release of pro-inflammatory cytokines.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
EBV-transformed human cells
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody EBVCS-5 recognizes an epitope located in the stalk region of human low affinity IgE receptor (CD23) between the 37 and 25 kDa cleavage sites.
CD22, also known as Siglec-2 (sialic acid-binding immunoglobulin-like lectin-2) is a transmembrane glycoprotein binding alpha2,6-linked sialic acid-bearing ligands. Intracellular domain of CD22 recruits protein tyrosine phosphatase SHP-1 through the immunoreceptor tyrosine-based inhibitory motifs (ITIMs), thus setting a treshold for B cell receptor-mediated activation. CD22 also regulates B-cell response by involvement in controlling the CD19/CD21-Src-family protein tyrosine kinase amplification pathway and CD40 signaling. CD22 exhibits hallmarks of clathrin-mediated endocytic pathway.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Whole hairy cell leukemia cells and membrane preparation
Applications:
FC
Additional Info:
The mouse monoclonal antibody S-HCL-1 (also known as S-HCL1) recognizes CD22 (BL-CAM), a 130 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed in the cytoplasm of pro-B and pre-B lymphocytes, and on the surface of mature and activated B lymphocytes; it is lost on plasma cells, peripheral blood T lymphocytes, granulocytes and monocytes._x000D_ <br><b>HLDA IV; WS Code B48</b>
CD22, also known as Siglec-2 (sialic acid-binding immunoglobulin-like lectin-2) is a transmembrane glycoprotein binding alpha2,6-linked sialic acid-bearing ligands. Intracellular domain of CD22 recruits protein tyrosine phosphatase SHP-1 through the immunoreceptor tyrosine-based inhibitory motifs (ITIMs), thus setting a treshold for B cell receptor-mediated activation. CD22 also regulates B-cell response by involvement in controlling the CD19/CD21-Src-family protein tyrosine kinase amplification pathway and CD40 signaling. CD22 exhibits hallmarks of clathrin-mediated endocytic pathway.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Whole hairy cell leukemia cells and membrane preparation
Applications:
FC
Additional Info:
The mouse monoclonal antibody S-HCL-1 (also known as S-HCL1) recognizes CD22 (BL-CAM), a 130 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed in the cytoplasm of pro-B and pre-B lymphocytes, and on the surface of mature and activated B lymphocytes; it is lost on plasma cells, peripheral blood T lymphocytes, granulocytes and monocytes._x000D_ <br><b>HLDA IV; WS Code B48</b>
CD22, also known as Siglec-2 (sialic acid-binding immunoglobulin-like lectin-2) is a transmembrane glycoprotein binding alpha2,6-linked sialic acid-bearing ligands. Intracellular domain of CD22 recruits protein tyrosine phosphatase SHP-1 through the immunoreceptor tyrosine-based inhibitory motifs (ITIMs), thus setting a treshold for B cell receptor-mediated activation. CD22 also regulates B-cell response by involvement in controlling the CD19/CD21-Src-family protein tyrosine kinase amplification pathway and CD40 signaling. CD22 exhibits hallmarks of clathrin-mediated endocytic pathway.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Whole hairy cell leukemia cells and membrane preparation
Applications:
FC
Additional Info:
The mouse monoclonal antibody S-HCL-1 (also known as S-HCL1) recognizes CD22 (BL-CAM), a 130 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed in the cytoplasm of pro-B and pre-B lymphocytes, and on the surface of mature and activated B lymphocytes; it is lost on plasma cells, peripheral blood T lymphocytes, granulocytes and monocytes._x000D_ <br><b>HLDA IV; WS Code B48</b>
CD20 is a cell surface 33-37 (depending on the degree of phosphorylation) kDa non-glycosylated surface phosphoprotein expressed on mature and most malignant B cells, but not stem cells or plasma cells (low number of the CD20 has been also detected on a subpopulation of T lymphocytes and it can be expressed on follicular dendritic cells). Its expression on B cells is synchronous with the expression of surface IgM. CD20 regulates transmembrane calcium conductance (probably functioning as a component of store-operated calcium channel), cell cycle progression and B-cell proliferation. It is associated with lipid rafts, but the intensity of this association depends on extracellular triggering, employing CD20 conformational change and/or BCR (B cell antigen receptor) aggregation. After the receptor ligation, BCR and CD20 colocalize and then rapidly dissociate before BCR endocytosis, whereas CD20 remains at the cell surface. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B cells, as it is expressed at high levels on most B-cell malignancies, but does not become internalized or shed from the plasma membrane following mAb treatment.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
RAMOS human lymphoma cell line
Applications:
FC,IHC
Additional Info:
The antibody MEM-269 reacts with CD20 (Bp35), a 33-37 kDa non-glycosylated membrane receptor with four transmembrane domains, expressed on B lymphocytes (it is lost on plasma cells), follicular dendritic cells, and at low levels on peripheral blood T lymphocytes.
CD1a, together with CD1b and c, belongs to group 1 of CD1 glycoproteins. These proteins serve as antigen-presenting molecules for a subset of T cells that responds to specific lipids and glycolipids found in the cell walls of bacterial pathogens or self-glycolipid antigens such as gangliosides, and they have also roles in antiviral immunity. Unlike CD1b, CD1a is excluded from late endosomal compartments and instead traffics independently in the recycling pathway of the early endocytic system, and CD1a antigen presentation is independent upon vesicular acidification.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody SK9 recognizes CD1a (T6), a 49 kDa polypeptide associated with beta2-microglobulin expressed on cortical thymocytes (strongly), Langerhans cells, dendritic cells and some T cell leukemias and lymphomas.
CD1a, together with CD1b and c, belongs to group 1 of CD1 glycoproteins. These proteins serve as antigen-presenting molecules for a subset of T cells that responds to specific lipids and glycolipids found in the cell walls of bacterial pathogens or self-glycolipid antigens such as gangliosides, and they have also roles in antiviral immunity. Unlike CD1b, CD1a is excluded from late endosomal compartments and instead traffics independently in the recycling pathway of the early endocytic system, and CD1a antigen presentation is independent upon vesicular acidification.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody SK9 recognizes CD1a (T6), a 49 kDa polypeptide associated with beta2-microglobulin expressed on cortical thymocytes (strongly), Langerhans cells, dendritic cells and some T cell leukemias and lymphomas.
CD1a, together with CD1b and c, belongs to group 1 of CD1 glycoproteins. These proteins serve as antigen-presenting molecules for a subset of T cells that responds to specific lipids and glycolipids found in the cell walls of bacterial pathogens or self-glycolipid antigens such as gangliosides, and they have also roles in antiviral immunity. Unlike CD1b, CD1a is excluded from late endosomal compartments and instead traffics independently in the recycling pathway of the early endocytic system, and CD1a antigen presentation is independent upon vesicular acidification.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody SK9 recognizes CD1a (T6), a 49 kDa polypeptide associated with beta2-microglobulin expressed on cortical thymocytes (strongly), Langerhans cells, dendritic cells and some T cell leukemias and lymphomas.
CD1a, together with CD1b and c, belongs to group 1 of CD1 glycoproteins. These proteins serve as antigen-presenting molecules for a subset of T cells that responds to specific lipids and glycolipids found in the cell walls of bacterial pathogens or self-glycolipid antigens such as gangliosides, and they have also roles in antiviral immunity. Unlike CD1b, CD1a is excluded from late endosomal compartments and instead traffics independently in the recycling pathway of the early endocytic system, and CD1a antigen presentation is independent upon vesicular acidification.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
Human thymocytes
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody SK9 recognizes CD1a (T6), a 49 kDa polypeptide associated with beta2-microglobulin expressed on cortical thymocytes (strongly), Langerhans cells, dendritic cells and some T cell leukemias and lymphomas.
CD173 (blood group antigen H2) is a fucosylated saccharide (Fuc-alpha-1-2-Gal-beta-1-4-GlcNAc-beta) generated by beta-D-galactoside 2-alpha-L-fucosyltransferase (FUT1). CD173 belongs to markers of early hematopoiesis; it is expressed mainly on CD34-positive hematopoietic progenitor cells. CD173 is a precursor structure of CD174 (Lewis Y) and is also structurally related to CD15 (Lewis X). On endothelial cells CD173 and CD174 are concentrated on pseudopodial extensions responsible for initial contacts between endothelial cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
Human thrombocytes
Applications:
FC
Additional Info:
The antibody MEM-198 reacts with CD173 (H2), an extracellular saccharide antigen expressed mainly during early hematopoiesis; it is also expressed on endothelial cells.
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
A mixture of U266 and XG-1 human myeloma cell lines
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody MI15 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes.
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
A mixture of U266 and XG-1 human myeloma cell lines
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody MI15 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes.
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
U266 human peripheral blood myeloma cell line
Applications:
FC,IHC
Additional Info:
The antibody B-A38 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes. _x000D_
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
U266 human peripheral blood myeloma cell line
Applications:
FC,IHC
Additional Info:
The antibody B-A38 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes. _x000D_
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
A mixture of U266 and XG-1 human myeloma cell lines
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody MI15 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes.
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
U266 human peripheral blood myeloma cell line
Applications:
FC,IHC
Additional Info:
The antibody B-A38 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes. _x000D_
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store in the dark at 2-8°C. Do not freeze. Avoid prolonged exposure to light. Do not use after expiration date stamped on vial label.
Immunogen:
A mixture of U266 and XG-1 human myeloma cell lines
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody MI15 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes.
CD138 (syndecan 1) is a transmembrane proteoglycan that can bind a variety of cytokines and modulate their activity, as well as the activity of extracellular matrix components and influence many developmental processes. CD138 is expressed mainly in differentiating keratinocytes and is transiently upregulated in all layers of the epidermis upon tissue injury. It is also highly expressed on plasma cells and can be detected even on fibroblasts, vascular smooth muscle cells and endothelial cells. Up-regulation and down-regulation of CD138 on the cell surface often correlates with the gain of cancerous characteristics. Serum levels of the shedded soluble sCD138 are used as a prognostic factor of cancerogenesis. _x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
Immunogen:
A mixture of U266 and XG-1 human myeloma cell lines
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody MI15 recognizes CD138 (syndecan 1), a 65-70 kDa heparan sulfate proteoglycan expressed mainly in the epidermis and plasma cells, but also in growth factor-stimulated lymphocytes.
CD107a (lysosome-associated membrane protein-1, LAMP-1), together with LAMP-2, is a major constituent of lysosomal membrane, 1-2% of total CD107a is found also on the plasma membrane. The LAMP proteins are involved in lysosome biogenesis and are required for fusion of lysosomes with phagosomes. Increased CD107a immunoreactivity is observed in neurones, and in glial cells surrounding senile plaques in Alzheimers disease cases and is localized mainly in medullary epithelial cells, single macrophages and lymphocytes in acute thymic involution. CD107a is a good marker of mast cell activation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on the label.
Immunogen:
U937 human Caucasian hystiocytic lymphoma cell line
Applications:
FC,IHC,ICC
Additional Info:
The antibody B-T47 recognizes CD107a, a 100-120 kDa glycoprotein expressed mainly on lysosomal, but also on the plasma membrane. _x000D_
The antibody HEB-29 reacts with human blood group B. The specifity of the antibody HEB-29 was confirmed by comparison of specifity and reactivity to standard reagent using >5.000 samples of blood.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mixture of erythrocytes of group B and glycoprotein fraction isolated from saliva of secretors with blood group B.
Applications:
AGG,IHC
Additional Info:
The antibody HEB-29 reacts with human blood group B. The specifity of the antibody HEB-29 was confirmed by comparison of specifity and reactivity to standard reagent using >5 000 samples of blood.
The antibody HE-10 agglutinates erythrocytes of group A but does not agglutinate erythrocytes of group B and 0. Study with specific oligosaccharides showed that the antibody HE-10 reacts with A and H antigens with chain types 3 and 4 and it does not react with A disaccharide, A trisaccharide, A type 1, A type 2, ALe<sup>b</sup>.<br>The antibody HE-10 does not react with normal tissue sections of donors with blood group B and 0 but it reacts specifically with malignant tissues.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mixture of erythrocytes of group A1 and glycoprotein fraction isolated from saliva of secretors with blood group A.
Applications:
IHC
Additional Info:
The mouse monoclonal antibody HE-10 agglutinates erythrocytes of group A, and is excellent as a tumour marker in patients of blood group B and 0. It does not agglutinate erythrocytes of group B and 0. Study with specific oligosaccharides showed that the antibody HE-10 reacts with A and H antigens with chain types 3 and 4 and it does not react with A disaccharide, A trisaccharide, A type 1, A type 2, ALeb. The antibody HE-10 does not react with normal tissue sections of donors with blood group B and 0 but it reacts specifically with malignant tissues.
Clone number:
HE-10
Antibody Isotype:
IgM
Application Details:
Immunohistochemistry (paraffin sections): The antibody HE-10 is excellent as a tumour marker in patients of blood group B and 0. Flow cytometry: Recommended dilution: 1-3 : 100.
The antibody HE-24 distinguishes blood group A<sub>1</sub>B from A<sub>2</sub>B. The specifity of the antibody HE-24 was verified on >1000 samples of blood.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Glycoprotein fraction isolated from saliva of secretors with blood group A.
Applications:
AGG
Additional Info:
The antibody HE-24 distinguishes blood group A1B from A2B. The specifity of the antibody HE-24 was verified on >1000 samples of blood.
Human blood group A antigen belongs to a group of carbohydrate determinats carried on both glycolipids and glycoproteins; it is detected on erythrocytes and certain epithelial cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mixture of erythrocytes of group A1 and glycoprotein fraction isolated from saliva of secretors with blood group A.
Applications:
IHC,AGG
Additional Info:
The antibody HE-193 recognizes human blood group A (monofucosyl and difucosyl A antigens with chain types 1 and 2, A antigens with chain types 3, 4, 5, 6) and Forssman antigen.
Human blood group A antigen belongs to a group of carbohydrate determinats carried on both glycolipids and glycoproteins; it is detected on erythrocytes and certain epithelial cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mixture of erythrocytes of group A1 and glycoprotein fraction isolated from saliva of secretors with blood group A.
Applications:
AGG
Additional Info:
The antibody HE-195 recognizes human blood group A including weak variants A3, AX, A3B, AXB. The specifity of antibody HE-195 was confirmed by comparison of specifity and reactivity to standard reagent using >5.000 samples of blood.
Bim (Bcl2-interacting mediator) is a pro-apoptotic protein of BH3 domain-only subgroup of the Bcl2 family. It has important roles in initiation of apoptosis in response to many death stimuli. Bim is an important regulator of B and T cell negative selection and is also an essential regulator of T cell apoptosis during termination of an immune response. Bim is constitutively expressed in many cell types but it is maintained in an inactive form through binding to the microtubule-associated dynein motor complex._x000D_
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze. Do not use after expiration date stamped on vial label.
The Armenian hamster antibody Ham151-149 reacts with mouse Bim, a 19-24 kDa pro-apoptotic protein (Bcl-2 family) which regulates immunological responses._x000D_
The ZAP70 (zeta-associated protein of 70 kDa) tyrosine kinase was identified as a tyrosine phosphoprotein that associates with TCR zeta subunit and undergoes tyrosine phosphorylation following TCR stimulation. ZAP70 is a Syk family tyrosine kinase primarily expressed in T and NK cells that plays an essential role in signaling through the TCR. TCR-mediated activation of T cells is crucial to the immune response. In humans, ZAP70 gene mutations resulting in lower ZAP70 protein expression levels or expression of catalytically inactive ZAP70 proteins, have been identified. ZAP70 deficiency results in the absence of mature CD8+ T cells and the prevention of TCR-mediated activation of CD4+ T cells, and it can lead to severe combined immunodeficiency.In patients with chronic lymphocytic leukemia (B-CLL), ZAP70 expression on B cell was shown to be correlated with disease progression and survival. ZAP70 contains two N-terminal SH2 domains (Src homology domain 2) and a C-terminal kinase domain. During T cell activation, the binding of ZAP70 SH2 domains to the phosphorylated zeta subunit on the activated TCR complex causes a colocalization with the Lck tyrosine kinase that phosphorylates ZAP70 on Tyr493 in the activation loop. ZAP70 autophosphorylates multiple tyrosines in the region between the SH2 domains and the kinase domain, including the binding sites for additional SH2-containing signaling proteins such as SLP76, LAT, Lck, PLCgamma1, Vav, Shc, Ras-GAP, and Abl. ZAP70-mediated activation of these downstream effectors leads to the release of intracellular calcium stores, and the transcription of interleukin-2 and other genes important for an immune response.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed fusion protein representing C-terminal part (160 amino acids) of human ZAP70 with histidine tag
Applications:
WB
Additional Info:
The polyclonal antibody recognizes C-terminal part of human ZAP70 protein tyrosine kinase (intracellular antigen). ZAP70 is a molecule susceptible to degradation. It is recommended to use freshly prepared cell lysates (protease inhibitors are essential) to avoid non-specific staining of degradation products.
The ZAP70 (zeta-associated protein of 70 kDa) tyrosine kinase was identified as a tyrosine phosphoprotein that associates with TCR zeta subunit and undergoes tyrosine phosphorylation following TCR stimulation. ZAP70 is a Syk family tyrosine kinase primarily expressed in T and NK cells that plays an essential role in signaling through the TCR. TCR-mediated activation of T cells is crucial to the immune response. In humans, ZAP70 gene mutations resulting in lower ZAP70 protein expression levels or expression of catalytically inactive ZAP70 proteins, have been identified. ZAP70 deficiency results in the absence of mature CD8+ T cells and the prevention of TCR-mediated activation of CD4+ T cells, and it can lead to severe combined immunodeficiency.In patients with chronic lymphocytic leukemia (B-CLL), ZAP70 expression on B cell was shown to be correlated with disease progression and survival. ZAP70 contains two N-terminal SH2 domains (Src homology domain 2) and a C-terminal kinase domain. During T cell activation, the binding of ZAP70 SH2 domains to the phosphorylated zeta subunit on the activated TCR complex causes a colocalization with the Lck tyrosine kinase that phosphorylates ZAP70 on Tyr493 in the activation loop. ZAP70 autophosphorylates multiple tyrosines in the region between the SH2 domains and the kinase domain, including the binding sites for additional SH2-containing signaling proteins such as SLP76, LAT, Lck, PLCgamma1, Vav, Shc, Ras-GAP, and Abl. ZAP70-mediated activation of these downstream effectors leads to the release of intracellular calcium stores, and the transcription of interleukin-2 and other genes important for an immune response.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed fusion protein representing C-terminal part (160 amino acids) of human ZAP70 with histidine tag
Applications:
FC,WB,ICC
Additional Info:
The antibody ZAP-03 reacts with ZAP70, a 70 kDa protein tyrosine kinase expressed in T and NK cells (intracellular antigen). ZAP70 is a molecule susceptible to degradation. It is recommended to use freshly prepared cell lysates (protease inhibitors are essential) to avoid non-specific staining of degradation products.
Clone number:
ZAP-03
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Intracellular staining; recommended dilution: 2-5 ?g/ml; positive control: HPB-ALL human peripheral blood T cell leukemia cell line. Western blotting: Recommended dilution: 0,5 ?g/ml; positive control: HPB-ALL human peripheral blood T cell leukemia cell line; negative control: RAMOS human Burkitt lymphoma cell line; reducing conditions, 10% separating gel.
Vimentin (57 kDa) is the most ubiquituos intermediate filament protein and the first to be expressed during cell differentiation. All primitive cell types express vimentin but in most non-mesenchymal cells it is replaced by other intermediate filament proteins during differentiation. Vimentin is expressed in a wide variety of mesenchymal cell types - fibroblasts, endothelial cells etc., and in a number of other cell types derived from mesoderm, e.g., mesothelium and ovarian granulosa cells. In non-vascular smooth muscle cellsand striated muscle, vimentin is often replaced by desmin, however, during regeneration, vimentin is reexpressed. Cells of the lymfo-haemopoietic system (lymphocytes, macrophages etc.) also express vimentin, sometimes in scarce amounts. Vimentin is also found in mesoderm derived epithelia, e.g. kidney (Bowman capsule), endometrium and ovary (surface epithelium), in myoepithelial cells (breast, salivary and sweat glands), an in thyroid gland epithelium. In these cell types, as in mesothelial cells, vimentin is coexpressed with cytokeratin.Furthermore, vimentin is detected in many cells from the neural crest. Particularly melanocytes express abundant vimentin. In glial cells vimentin is coexpressed with Glial Fibrillary Acidic Protein (GFAP). Vimentin is present in many different neoplasms but is particulary expressed in those originated from mesenchymal cells. Sarcomas e.g., fibrosarcoma, malignt fibrous histiocytoma, angiosarcoma, and leio- and rhabdomyosarcoma, as well as lymphomas, malignant melanoma and schwannoma, are virtually always vimentin positive. Mesoderm derived carcinomas like renal cell carcinoma, adrenal cortical carcinoma and adenocarcinomas from endometrium and ovary usually express vimentin. Also thyroid carcinomas are vimentin positive. Any low differentiated carcinoma may express some vimentin. Vimentin is frequently included in the so-called primary panel (together with CD45, cytokeratin, and S-100 protein). Intense staining reaction for vimentin without coexpression of other intermediate filament proteins is strongly suggestive of a mesenchymal tumour or malignant melanoma.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
IP,WB,IHC,ICC
Additional Info:
The antibody VI-10 reacts with vimentin, a 57 kDa intermediate filament intracellular protein expressed in variety of mesenchymal and mesodermal cell types.
Clone number:
VI-10
Antibody Isotype:
IgM
Application Details:
Immunocytochemistry: Staining technique: (a) fix cells for 10 min in methanol at -20°C and for 6 min in acetone at -20°C; (b) fix cells directly in methanol for 10 min at -20°C or in acetone for 10 min at -20°C. Positive control: 3T3 murine Swiss albino fibroblast cell line, RBL rat basophilic leukemia cell line. Immunohistochemistry (paraffin sections): Recommended dilution: 5 ?g/ml, positive tissue: skin fibroblast.Western blotting: Recommended dilution: 1-2 ?g/ml.
Vimentin (57 kDa) is the most ubiquituos intermediate filament protein and the first to be expressed during cell differentiation. All primitive cell types express vimentin but in most non-mesenchymal cells it is replaced by other intermediate filament proteins during differentiation. Vimentin is expressed in a wide variety of mesenchymal cell types - fibroblasts, endothelial cells etc., and in a number of other cell types derived from mesoderm, e.g., mesothelium and ovarian granulosa cells. In non-vascular smooth muscle cellsand striated muscle, vimentin is often replaced by desmin, however, during regeneration, vimentin is reexpressed. Cells of the lymfo-haemopoietic system (lymphocytes, macrophages etc.) also express vimentin, sometimes in scarce amounts. Vimentin is also found in mesoderm derived epithelia, e.g. kidney (Bowman capsule), endometrium and ovary (surface epithelium), in myoepithelial cells (breast, salivary and sweat glands), an in thyroid gland epithelium. In these cell types, as in mesothelial cells, vimentin is coexpressed with cytokeratin.Furthermore, vimentin is detected in many cells from the neural crest. Particularly melanocytes express abundant vimentin. In glial cells vimentin is coexpressed with Glial Fibrillary Acidic Protein (GFAP). Vimentin is present in many different neoplasms but is particulary expressed in those originated from mesenchymal cells. Sarcomas e.g., fibrosarcoma, malignt fibrous histiocytoma, angiosarcoma, and leio- and rhabdomyosarcoma, as well as lymphomas, malignant melanoma and schwannoma, are virtually always vimentin positive. Mesoderm derived carcinomas like renal cell carcinoma, adrenal cortical carcinoma and adenocarcinomas from endometrium and ovary usually express vimentin. Also thyroid carcinomas are vimentin positive. Any low differentiated carcinoma may express some vimentin. Vimentin is frequently included in the so-called primary panel (together with CD45, cytokeratin, and S-100 protein). Intense staining reaction for vimentin without coexpression of other intermediate filament proteins is strongly suggestive of a mesenchymal tumour or malignant melanoma.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed full-length human vimentin
Applications:
IHC,FC,WB,ICC,ELISA
Additional Info:
The antibody VI-RE/1 reacts with human vimentin, a 57 kDa intermediate filament intracellular protein expressed on a wide variety of mesenchymal and mesodermal cell types.
Clone number:
VI-RE/1
Antibody Isotype:
IgG1
Application Details:
ELISA: The antibody VI-RE/1 recognizes different epitope on human vimentin than the antibody VI-01 (IgM). Flow cytometry: Recommended dilution: 1-4 ?g/ml. Intracellular staining.Western blotting: Recommended dilution: 1-2 ?g/ml.Immunocytochemistry: Recommended dilution: 5-10 ?g/ml.
Vimentin (57 kDa) is the most ubiquituos intermediate filament protein and the first to be expressed during cell differentiation. All primitive cell types express vimentin but in most non-mesenchymal cells it is replaced by other intermediate filament proteins during differentiation. Vimentin is expressed in a wide variety of mesenchymal cell types - fibroblasts, endothelial cells etc., and in a number of other cell types derived from mesoderm, e.g., mesothelium and ovarian granulosa cells. In non-vascular smooth muscle cellsand striated muscle, vimentin is often replaced by desmin, however, during regeneration, vimentin is reexpressed. Cells of the lymfo-haemopoietic system (lymphocytes, macrophages etc.) also express vimentin, sometimes in scarce amounts. Vimentin is also found in mesoderm derived epithelia, e.g. kidney (Bowman capsule), endometrium and ovary (surface epithelium), in myoepithelial cells (breast, salivary and sweat glands), an in thyroid gland epithelium. In these cell types, as in mesothelial cells, vimentin is coexpressed with cytokeratin.Furthermore, vimentin is detected in many cells from the neural crest. Particularly melanocytes express abundant vimentin. In glial cells vimentin is coexpressed with Glial Fibrillary Acidic Protein (GFAP). Vimentin is present in many different neoplasms but is particulary expressed in those originated from mesenchymal cells. Sarcomas e.g., fibrosarcoma, malignt fibrous histiocytoma, angiosarcoma, and leio- and rhabdomyosarcoma, as well as lymphomas, malignant melanoma and schwannoma, are virtually always vimentin positive. Mesoderm derived carcinomas like renal cell carcinoma, adrenal cortical carcinoma and adenocarcinomas from endometrium and ovary usually express vimentin. Also thyroid carcinomas are vimentin positive. Any low differentiated carcinoma may express some vimentin. Vimentin is frequently included in the so-called primary panel (together with CD45, cytokeratin, and S-100 protein). Intense staining reaction for vimentin without coexpression of other intermediate filament proteins is strongly suggestive of a mesenchymal tumour or malignant melanoma.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Pellet of porcine brain cold stable proteins after depolymerization of microtubules.
Applications:
IHC,WB,ICC
Additional Info:
The antibody VI-01 reacts with vimentin, a 57 kDa intermediate filament intracellular protein expressed in variety of mesenchymal and mesodermal cell types. Cross-reactivity was found with smooth muscle desmin.
Clone number:
VI-01
Antibody Isotype:
IgM
Application Details:
Immunocytochemistry: Staining technique: (a) fix cells for 10 min in methanol at -20°C and for 6 min in acetone at -20°C; (b) fix cells directly in methanol for 10 min at -20°C or in acetone for 10 min at -20°C. Positive control: 3T3 murine Swiss albino fibroblast cell line, RBL rat basophilic leukemia cell line.
Vimentin (57 kDa) is the most ubiquituos intermediate filament protein and the first to be expressed during cell differentiation. All primitive cell types express vimentin but in most non-mesenchymal cells it is replaced by other intermediate filament proteins during differentiation. Vimentin is expressed in a wide variety of mesenchymal cell types - fibroblasts, endothelial cells etc., and in a number of other cell types derived from mesoderm, e.g., mesothelium and ovarian granulosa cells. In non-vascular smooth muscle cellsand striated muscle, vimentin is often replaced by desmin, however, during regeneration, vimentin is reexpressed. Cells of the lymfo-haemopoietic system (lymphocytes, macrophages etc.) also express vimentin, sometimes in scarce amounts. Vimentin is also found in mesoderm derived epithelia, e.g. kidney (Bowman capsule), endometrium and ovary (surface epithelium), in myoepithelial cells (breast, salivary and sweat glands), an in thyroid gland epithelium. In these cell types, as in mesothelial cells, vimentin is coexpressed with cytokeratin.Furthermore, vimentin is detected in many cells from the neural crest. Particularly melanocytes express abundant vimentin. In glial cells vimentin is coexpressed with Glial Fibrillary Acidic Protein (GFAP). Vimentin is present in many different neoplasms but is particulary expressed in those originated from mesenchymal cells. Sarcomas e.g., fibrosarcoma, malignt fibrous histiocytoma, angiosarcoma, and leio- and rhabdomyosarcoma, as well as lymphomas, malignant melanoma and schwannoma, are virtually always vimentin positive. Mesoderm derived carcinomas like renal cell carcinoma, adrenal cortical carcinoma and adenocarcinomas from endometrium and ovary usually express vimentin. Also thyroid carcinomas are vimentin positive. Any low differentiated carcinoma may express some vimentin. Vimentin is frequently included in the so-called primary panel (together with CD45, cytokeratin, and S-100 protein). Intense staining reaction for vimentin without coexpression of other intermediate filament proteins is strongly suggestive of a mesenchymal tumour or malignant melanoma.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Bacterially expressed full-length human vimentin
Applications:
FC
Additional Info:
The antibody VI-RE/1 reacts with human vimentin, a 57 kDa intermediate filament intracellular protein expressed on a wide variety of mesenchymal and mesodermal cell types.
Vimentin (57 kDa) is the most ubiquituos intermediate filament protein and the first to be expressed during cell differentiation. All primitive cell types express vimentin but in most non-mesenchymal cells it is replaced by other intermediate filament proteins during differentiation. Vimentin is expressed in a wide variety of mesenchymal cell types - fibroblasts, endothelial cells etc., and in a number of other cell types derived from mesoderm, e.g., mesothelium and ovarian granulosa cells. In non-vascular smooth muscle cellsand striated muscle, vimentin is often replaced by desmin, however, during regeneration, vimentin is reexpressed. Cells of the lymfo-haemopoietic system (lymphocytes, macrophages etc.) also express vimentin, sometimes in scarce amounts. Vimentin is also found in mesoderm derived epithelia, e.g. kidney (Bowman capsule), endometrium and ovary (surface epithelium), in myoepithelial cells (breast, salivary and sweat glands), an in thyroid gland epithelium. In these cell types, as in mesothelial cells, vimentin is coexpressed with cytokeratin.Furthermore, vimentin is detected in many cells from the neural crest. Particularly melanocytes express abundant vimentin. In glial cells vimentin is coexpressed with Glial Fibrillary Acidic Protein (GFAP). Vimentin is present in many different neoplasms but is particulary expressed in those originated from mesenchymal cells. Sarcomas e.g., fibrosarcoma, malignt fibrous histiocytoma, angiosarcoma, and leio- and rhabdomyosarcoma, as well as lymphomas, malignant melanoma and schwannoma, are virtually always vimentin positive. Mesoderm derived carcinomas like renal cell carcinoma, adrenal cortical carcinoma and adenocarcinomas from endometrium and ovary usually express vimentin. Also thyroid carcinomas are vimentin positive. Any low differentiated carcinoma may express some vimentin. Vimentin is frequently included in the so-called primary panel (together with CD45, cytokeratin, and S-100 protein). Intense staining reaction for vimentin without coexpression of other intermediate filament proteins is strongly suggestive of a mesenchymal tumour or malignant melanoma.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Bacterially expressed full-length human vimentin
Applications:
FC
Additional Info:
The antibody VI-RE/1 reacts with human vimentin, a 57 kDa intermediate filament intracellular protein expressed on a wide variety of mesenchymal and mesodermal cell types.
VCP (valosin-containing protein), also known as p97, TERA, ALS14, IBMPFD, HEL-220, IBMPFD1, or HEL-S-70, is a member of a protein family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. VCP is a structural protein that associates with clathrin and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. In sperm this intra-acrosomal protein can be used as a marker for evaluation of the physiological state of sperm cells as well as for selection of a suitable method of fertilization in the laboratories of assisted reproduction.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Freshly ejaculated human sperms were washed in PBS and extracted in 3% acetic acid, 10% glycerol, 30 mM benzaminidine. The acid extract was dialyzed against 0.2% acetic acid and subsequently used for immunization.
Applications:
FC,WB,ICC
Additional Info:
The antibody Hs-14 reacts with VCP (valosin-containing protein) a 220 kDa intra-acrosomal protein.
Clone number:
Hs-14
Antibody Isotype:
IgM
Application Details:
Immunocytochemistry: Recommended dilution: 10 ?g/ml, membrane permeabilization (acetone) is essential. The antibody Hs-14 is designed for quantitative immunofluorescence analysis of pathological sperms (excellent tool for laboratories of assisted reproduction when optimal method of fertilization is sought). Flow cytometry: Intraacrosomal staining; recommended dilution: 3-12 µg/ml.
VCP (valosin-containing protein), also known as p97, TERA, ALS14, IBMPFD, HEL-220, IBMPFD1, or HEL-S-70, is a member of a protein family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. VCP is a structural protein that associates with clathrin and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation. In sperm this intra-acrosomal protein can be used as a marker for evaluation of the physiological state of sperm cells as well as for selection of a suitable method of fertilization in the laboratories of assisted reproduction.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Freshly ejaculated human sperms were washed in PBS and extracted in 3% acetic acid, 10% glycerol, 30 mM benzaminidine. The acid extract was dialyzed against 0.2% acetic acid and subsequently used for immunization.
Applications:
FC
Additional Info:
The antibody Hs-14 reacts with VCP (valosin-containing protein) a 220 kDa intra-acrosomal protein.
Clone number:
Hs-14
Antibody Isotype:
IgM
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 20 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 50 tests. Intraacrosomal staining.
Ubinuclein 1 (UBN1) is a ubiquitously expressed evolutionarily conserved protein which binds to proliferation-promoting genes that are repressed by formation of senescence-associated heterochromatin foci (SAHF). Ubinuclein 1 associates with various transcription factors and with histone methyltransferase activity, is indispensable for SAHF formation and appears to be a regulator of senescence. Although in most cells ubinuclein is localized to the nucleus, in cells forming tight junctions it is recruited to the cell adhesion complexes, dependently on the cell density.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant protein corresponding to amino acids 1-190 of ubinuclein 1.
Applications:
IP,WB
Additional Info:
The antibody UBN1-02 recognizes N-terminal part of ubinuclein 1 (UBN1), a widely expressed nuclear and adhesion complex protein. Western blotting analysis reveals UBN1 as a 165 kDa band.
Clone number:
UBN1-02
Antibody Isotype:
IgG
Application Details:
Western blotting: Recommended dilution: 1-5 ?g/ml; positive control: HeLa cell line.
TRIM (T cell receptor-interacting molecule), also known as TRAT1 (T cell receptor associated transmembrane adaptor 1) is a 30 kDa protein expressed by T cells as a cystein-linked homodimer. It associates with TCR-CD3-zeta-chain complex and becomes phosphorylated by Src-family kinases. TRIM is potentially involved in negative regulation of TCR-mediated signaling, but its role remains unclear.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant intracellular domain (aa 29-186) of human TRIM.
Applications:
FC,IP,WB
Additional Info:
The antibody TRIM-04 recognizes an intracellular epitope of T cell receptor-interacting molecule (TRIM), a 30 kDa adaptor protein expressed by T cells.
Clone number:
TRIM-04
Antibody Isotype:
IgG2a
Application Details:
Flow cytometry: Intracellular staining. Western blotting: Non-reducing conditions.
TRIM (T cell receptor-interacting molecule), also known as TRAT1 (T cell receptor associated transmembrane adaptor 1) is a 30 kDa protein expressed by T cells as a cystein-linked homodimer. It associates with TCR-CD3-zeta-chain complex and becomes phosphorylated by Src-family kinases. TRIM is potentially involved in negative regulation of TCR-mediated signaling, but its role remains unclear.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant intracellular domain (aa 29-186) of human TRIM.
Applications:
FC
Additional Info:
The antibody TRIM-04 recognizes an intracellular epitope of T cell receptor-interacting molecule (TRIM), a 30 kDa adaptor protein expressed by T cells.
Transferrin is a monomeric glycoprotein of approximately 77 kDa, which serves as an iron-transporter. In normal plasma, transferrin has a concentration of 25-50 µmol / liter, and is usually about one-third saturated with iron, thus providing a large buffering capacity in case of an acute increase in plasma iron levels. Cells take up transferrin-iron complexes (holotransferrin) using transferrin receptor dimers. Upon binding of holotransferrin, the receptor is internalized by clathrin-mediated endocytosis. Acidification of endosomes by vesicular membrane proton pumps leads to dissociation of iron ions, whereas transferrin (apotransferrin) remains associated with its receptor (CD71) and recycles to the cell surface, where apotransferrin is released upon exposure to normal pH. Internalization of labeled transferrin thus represents an usefull approach to study endocytosis. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. Iron/transferrin complex is essential in haemoglobin synthesis and for certain types of cell division.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified porcine transferrin.
Applications:
WB,IHC,ICC,ELISA,RIA,FA
Additional Info:
The antibody HTF-14 recognizes an epitope located in the N-terminal domain of human serum transferrin, a 77 kDa single polypeptide chain glycoprotein (member of the iron binding family of proteins). It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+.
Clone number:
HTF-14
Antibody Isotype:
IgG1
Application Details:
Functional application: The antibody HTF-14 blocks binding of transferrin to its receptor. Immunohistochemistry (paraffin sections): Recommended dilution: 10 ?g/ml; positive tissue: placenta. Western blotting: non-reducing conditions, recommended dilution: 1-2 ?g/ml.
Transferrin is a monomeric glycoprotein of approximately 77 kDa, which serves as an iron-transporter. In normal plasma, transferrin has a concentration of 25-50 µmol / liter, and is usually about one-third saturated with iron, thus providing a large buffering capacity in case of an acute increase in plasma iron levels. Cells take up transferrin-iron complexes (holotransferrin) using transferrin receptor dimers. Upon binding of holotransferrin, the receptor is internalized by clathrin-mediated endocytosis. Acidification of endosomes by vesicular membrane proton pumps leads to dissociation of iron ions, whereas transferrin (apotransferrin) remains associated with its receptor (CD71) and recycles to the cell surface, where apotransferrin is released upon exposure to normal pH. Internalization of labeled transferrin thus represents an usefull approach to study endocytosis. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. Iron/transferrin complex is essential in haemoglobin synthesis and for certain types of cell division.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified porcine transferrin.
Applications:
WB,IHC,ICC,ELISA,RIA,FA
Additional Info:
The antibody HTF-14 recognizes an epitope located in the N-terminal domain of human serum transferrin, a 77 kDa single polypeptide chain glycoprotein (member of the iron binding family of proteins). It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+.
Clone number:
HTF-14
Antibody Isotype:
IgG1
Application Details:
Functional application: The antibody HTF-14 blocks binding of transferrin to its receptor. Immunohistochemistry (paraffin sections): Recommended dilution: 10 ?g/ml; positive tissue: placenta. Western blotting: non-reducing conditions, recommended dilution: 1-2 ?g/ml.
Transferrin is a monomeric glycoprotein of approximately 77 kDa, which serves as an iron-transporter. In normal plasma, transferrin has a concentration of 25-50 µmol / liter, and is usually about one-third saturated with iron, thus providing a large buffering capacity in case of an acute increase in plasma iron levels. Cells take up transferrin-iron complexes (holotransferrin) using transferrin receptor dimers. Upon binding of holotransferrin, the receptor is internalized by clathrin-mediated endocytosis. Acidification of endosomes by vesicular membrane proton pumps leads to dissociation of iron ions, whereas transferrin (apotransferrin) remains associated with its receptor (CD71) and recycles to the cell surface, where apotransferrin is released upon exposure to normal pH. Internalization of labeled transferrin thus represents an usefull approach to study endocytosis. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. Iron/transferrin complex is essential in haemoglobin synthesis and for certain types of cell division.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified porcine transferrin.
Applications:
WB,IHC,ICC,ELISA,RIA
Additional Info:
The antibody HTF-14 recognizes an epitope located in the N-terminal domain of human serum transferrin, a 77 kDa single polypeptide chain glycoprotein (member of the iron binding family of proteins). It is synthesised in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+.
TPX2 is a microtubule-associated protein, which is a critical regulator of mitosis. At the beginning of mitosis, TPX2 is released and plays a significant role in mitotic spindle formation and subsequent proper segregation of chromosomes during cell division. After completion of mitosis the TPX2 protein disappears, but has also role in DNA damage response. Its overexpression has been demonstrated in many types of carcinomas. TPX2 belongs to the markers of worse tumor prognosis. On the other hand, down-regulation of TPX2 can inhibit cancer cell proliferation, migration and invasion.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human TPX2
Applications:
IP,WB,IHC,ICC,ELISA
Additional Info:
The mouse monoclonal antibody TPX2-01 recognizes the epitope EPFVPKKEKKS (aa 636-646 in human) of TPX2, a microtubule-associated intracellular critical regulator of mitosis, which is overexpressed in many types of tumors and is a marker of worse prognosis in various cancers.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
WB,ELISA,FA
Additional Info:
The mouse monoclonal antibody MAb1 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb1
Antibody Isotype:
IgG1 k
Application Details:
Functional application: Neutralization. ELISA: It can be used as capture antibody in combination with biotinylated antibody MAb11.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
FC,IHC,ICC,ELISA
Additional Info:
The mouse monoclonal antibody MAb11 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb11
Antibody Isotype:
IgG1 k
Application Details:
ELISA: Biotinylated MAb11 can be used as a detection antibody in combination with capture antibody MAb1. Immunohistochemistry (frozen sections): paraformaldehyde-fixed, saponin-treated frozen tissue sections. Flow cytometry: Intracellular staining.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
WB,ELISA
Additional Info:
The mouse monoclonal antibody MAb1 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb1
Antibody Isotype:
IgG1 k
Application Details:
ELISA: It can be used as capture antibody in combination with biotinylated antibody MAb11.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
FC
Additional Info:
The mouse monoclonal antibody MAb11 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb11
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
FC
Additional Info:
The mouse monoclonal antibody MAb11 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb11
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests. Intracellular staining.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
TNF-alpha is a cytokine produced by monocytes, macrophages, neutrophils, NK cells, CD4+ T cells and many transformed cells. It can be expressed as a 17 kDa free molecule, or as a 26 kDa membrane protein. TNF-alpha easily forms stable trimers, but also other multimeric complexes. In the immune system, it is an important regulator, which has cytolytic and cytostatic activity against a range of tumor cells, increases fibroblast proliferation and supports neutrophil chemotaxis and phagocytosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant human TNF-alpha
Applications:
FC
Additional Info:
The mouse monoclonal antibody MAb11 recognizes human 17-26 kDa cytokine TNF-alpha (tumor necrosis factor alpha).
Clone number:
MAb11
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
Tissue non-specific alkaline phosphatase (TNAP), also known as liver/bone/kidney alkaline phosphatase, or MSCA-1 (mesenchymal stem cell antigen 1) is a selective marker for the prospective isolation of bone marrow-derived mesenchymal stem cells and mesenchymal stem-like cells. It is expressed at high levels in liver, bone, kidney, or endometrium, as well as on embryonic stem cells (ESCs). TNAP also plays a role in bone mineralization. Mutations in TNAP gene are associated with hypercalcemia and skeletal defects (hypophosphatasia).
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cell line
Applications:
FC
Additional Info:
The mouse monoclonal antibody W8B2B10 recognizes TNAP (tissue non-specific alkaline phosphatase), an ectoenzyme expressed mainly on embryonic stem cells, liver, bone, and kidney cells. This antibody is suitable for characterization of bone marrow-derived MSCs, iPSCs, and ESCs.
Tissue non-specific alkaline phosphatase (TNAP), also known as liver/bone/kidney alkaline phosphatase, or MSCA-1 (mesenchymal stem cell antigen 1) is a selective marker for the prospective isolation of bone marrow-derived mesenchymal stem cells and mesenchymal stem-like cells. It is expressed at high levels in liver, bone, kidney, or endometrium, as well as on embryonic stem cells (ESCs). TNAP also plays a role in bone mineralization. Mutations in TNAP gene are associated with hypercalcemia and skeletal defects (hypophosphatasia).
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cell line
Applications:
FC
Additional Info:
The mouse monoclonal antibody W8B2B10 recognizes TNAP (tissue non-specific alkaline phosphatase), an ectoenzyme expressed mainly on embryonic stem cells, liver, bone, and kidney cells. This antibody is suitable for characterization of bone marrow-derived MSCs, iPSCs, and ESCs.
Tissue non-specific alkaline phosphatase (TNAP), also known as liver/bone/kidney alkaline phosphatase, or MSCA-1 (mesenchymal stem cell antigen 1) is a selective marker for the prospective isolation of bone marrow-derived mesenchymal stem cells and mesenchymal stem-like cells. It is expressed at high levels in liver, bone, kidney, or endometrium, as well as on embryonic stem cells (ESCs). TNAP also plays a role in bone mineralization. Mutations in TNAP gene are associated with hypercalcemia and skeletal defects (hypophosphatasia).
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cell line
Applications:
ICC,FC
Additional Info:
The mouse monoclonal antibody W8B2B10 recognizes TNAP (tissue non-specific alkaline phosphatase), an ectoenzyme expressed mainly on embryonic stem cells, liver, bone, and kidney cells. This antibody is suitable for characterization of bone marrow-derived MSCs, iPSCs, and ESCs.
TIAR is an ubiquitously expressed RNA-binding protein, which regulates translational control, splicing, and other activities, including apoptosis. TIAR attenuates CDK1 activity, and is essential for the G2/M checkpoint. It accumulates in nuclear foci in late G2 phase and prophase in cells under replication stress. In steady state TIAR shuttles between the cytoplasm and the nucleus, probably as a part of nucleocytoplasmic transport of mRNA, but under stress conditions it accumulates mRNA molecules in granules and prevents their translation. Nucleolytic activity of TIAR against attacked target cells of cytotoxic lymphocytes has also been reported. Similarly, e.g. in permeabilized thymocytes TIAR triggers DNA fragmentation.
Thyroid disorders are often associated with autoimmune diseases and thyroid cancer.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
thyroid follicular cells
Applications:
IHC
Additional Info:
The antibody 2H11 recognizes thyroglobulin (TG), a 610 kDa extracellular secreted glycoprotein specific to the thyroid gland. TG is mainly expressed on thyroid follicular cells (99,1 %).
TFG (TRK-fused gene protein) is a regulatory protein with not fully understood function. Its defects are associated with various carcinomas, such as e.g. melanoma, thyroid papillary carcinoma, or glioma. TFG structure (multiple protein interaction motifs) indicated it can be an adaptor protein. It has been demonstrated TFG interacts with proteins modulating the NFkappaB pathway (TANK and NEMO). TNG enhances the effect of TNFalpha, TANK, TRAF2 and TRAF6 in inducing NFkappaB activity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human recombinant protein Trx-his-NTFG
Applications:
IP,WB,ICC
Additional Info:
The mouse monoclonal antibody TFG-03 recognizes TFG, an approximately 50 kDa intracellular protein with regulatory functions.
Tenascin C is an approximately 250 kDa extracellular matrix glycoprotein with important roles in the nervous system, as it promotes correct migration of growing axons during development and during neuronal regeneration. It is also involved in synaptic plasticity. Ligands of tenascin C are integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3, and alpha-V/beta-6. Similarly to neural cells, it also stimulates angiogenesis by promoting elongation and migration of endothelial cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Protein preparation from a homogenate of a human mammary tumour specimen.
Applications:
IHC,IP,WB
Additional Info:
The antibody T2H5 recognizes tenascin, a large hexameric extracellular matrix glycoprotein.
Clone number:
T2H5
Antibody Isotype:
IgG1
Application Details:
Immunohistochemistry (paraffin sections): Immunohistochemical detection of tenascin is valuable for studies of tissue differentiation and tumour growth. The antibody T2H5 is excellent for staining of paraffin-embedded tissue sections.Western blotting: Recommended dilution: 1-2 ?g/ml.
Mycobacterium tuberculosis protein Tb7.7, also known as Rv2654c, is being used for lymfocyte stimulation against Mycobacterium in combination with EsaT-6 and CFP-10 proteins.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant Tb7.7 protein (produced in E. coli)
Applications:
WB,ELISA
Additional Info:
The rabbit polyclonal antibody to Tb7.7 reacts with the Mycobacterium tuberculosis protein Tb7.7 (Rv2654c).
The Mycobacterium tuberculosis antigen Tb10.4, also known as EsxH, Rv0288, ESAT-6 like protein EsxH, or Cfp7, is a conserved bacterial protein which effectively induces immune response to M. tuberculosis infection. It is a promissing vaccination tool.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant Tb10.4 protein produced in E. coli
Applications:
WB,ELISA
Additional Info:
The rabbit polyclonal antibody to Tb10.4 reacts with Mycobacterium tuberculosis protein Tb10.4 (EsxH).
The Mycobacterium tuberculosis antigen Tb10.3, also known as EsxR, ESAT-6 like protein 9 (ES6_9), or Rv3019c, is an almost uncharacterized conserved bacterial protein.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant Tb10.3 protein (produced in E. coli)
Applications:
WB,ELISA
Additional Info:
The rabbit polyclonal antibody to Tb10.3 reacts with Mycobacterium tuberculosis protein Tb10.3 (EsxR).
The p53 family of proteins includes three members, p53, p63, and p73. The protein p63 is encoded by TP63 gene, which gives rise to protein isoforms with different properties and functions due to the presence (TAp63) or absence (deltaNp63) of an N-terminal transactivation domain. Immunohistochemistry of p63 has a clinical relevance for certain tumor types, but investigations have been hampered by a lack of well characterized antibodies that are specific for p63, do not cross-react with the related p53 and p73 proteins, and allow for discrimination between p63 isoforms TAp63 and deltaNp63 with opposite functional properties.
Syk is a cytoplasmic protein tyrosine kinase that translocates to the plasma membrane upon B cell antigen receptor (BCR) or the high-affinity IgE receptor (FcepsilonRI) triggering, and phosphorylates downstream adaptor proteins, thereby providing docking sites for initiation of subsequent signaling pathways, such as calcium mobilization, cytoskeleton remodeling, or transcription of specific genes. Syk binds to the receptor assemblies through interactions of its pair of SH2 domains with ITAM motives of the receptor, which have been phosphorylated by Src-family kinases. These kinases also help to activate Syk by phosphorylation of its activation loop.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant fragment (aa 5-360) of human Syk.
Applications:
IP,WB,IHC,ICC
Additional Info:
The antibody SYK-01 reacts with protein tyrosine kinase p72Syk (Syk; an intracellular antigen), which is required for the transduction of signals through the B cell antigen receptor (BCR) and the high affinity IgE receptor (FcepsilonRI).
Clone number:
SYK-01
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1-2 ?g/ml; positive control: RBL rat basophilic leukemia cell line, A-431 human epidermoid carcinoma cell line, RAMOS lymphoma cell line, U-937 human histiocytic lymphoma cell line, JURKAT human peripheral blood T cell leukemia cell line; negative control: HeLa human cervix carcinoma cell line; non-reducing conditions. Immunohistochemistry (paraffin sections): Recommended dilution: 5 ?g/ml; positive tissue: tonsil B cells.
STIM1 (stromal interacting molecule; also known as GOK) acts as a sensor of calcium depletion within the endoplasmic reticulum and transduces the signal to Orai1, the presumptive CRAC channel at the plasma membrane. Following decrease of luminal calcium concentration, STIM1 oligomerizes and induces Orai1 to enable entry of extracellular calcium into the cytoplasm. However, the precise mechanism of STIM1-Orai1 interaction has not been elucidated yet. Many questions also remain to be solved around STIM1 functional distribution. It turns out that STIM1 associates with growing ends of microtubules and is involved in endoplasmic reticulum tubule extension.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Synthetized peptide (C-terminal cytoplasmic part of STIM1).
Applications:
IP,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody CDN3H4 reacts with a cytoplasmic epitope of human and rodent STIM1, a 84 kDa essential and conserved regulator of store-operated Ca2+ channel function.
Clone number:
CDN3H4
Antibody Isotype:
IgG1
Application Details:
Immunocytochemistry: Methanol-aceton fixation; positive control: HeLa human cervix carcinoma cell line.Immunohistochemistry (paraffin sections): Recommended dilution: 5 ?g/ml.Western blotting: Recommended dilution: 1 ?g/ml; positive control: RBL rat basophilic leukemia cell line; both reducing and non-reducing conditions.
STAT1 (signal transducer and activator of transcription 1) is a transcription factor that plays important roles in growth arrest, apoptosis promoting and tumour suppression. After ligation of cytokine receptors STAT1 becomes phosphorylated on Tyr701 by Janus kinase JAK1 or JAK2, dimerizes, translocates to nucleus and contacts DNA. STAT1-STAT2 heterodimers serve as more potent transcriptional inducers than STAT1 homodimers. STAT1 is also phosphorylated on Ser727 by MAPK pathway, independently of tyrosine phosphorylation. However, the both modifications are important for its maximal transcriptional activity. On the other hand, STAT1 phosphorylated on Ser727 is targeted for proteasomal degradation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
STAT1 peptide sequence 8-23 (QLDSKFLEQVHQLYD) conjugated to KLH.
Applications:
IP,WB
Additional Info:
The antibody SM2 recognizes an epitope included within amino acids 8-23 of STAT1, a 91 kDa transcriptional factor involved in a variety of systems including antiviral responses and interferon alpha (IFN-alpha) and gamma (IFN-gamma) signal transduction.
STAT1 (signal transducer and activator of transcription 1) is a transcription factor that plays important roles in growth arrest, apoptosis promoting and tumour suppression. After ligation of cytokine receptors STAT1 becomes phosphorylated on Tyr701 by Janus kinase JAK1 or JAK2, dimerizes, translocates to nucleus and contacts DNA. STAT1-STAT2 heterodimers serve as more potent transcriptional inducers than STAT1 homodimers. STAT1 is also phosphorylated on Ser727 by MAPK pathway, independently of tyrosine phosphorylation. However, the both modifications are important for its maximal transcriptional activity. On the other hand, STAT1 phosphorylated on Ser727 is targeted for proteasomal degradation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
STAT1 peptide sequence 721-733 (DNLLPMSPEEFDE).
Applications:
IP,WB,IHC
Additional Info:
The antibody SM1 recognizes an epitope included within amino acids 721-733 of STAT1, a 91 kDa transcriptional factor involved in a variety of systems including antiviral responses and interferon alpha (IFN-alpha) and gamma (IFN-gamma) signal transduction.
The guanine nucleotide exchange factor Sos (son-of-sevenless) is a complex multidomain protein that activates the small GTPase Ras (H-Ras, K-Ras, N-Ras, but not functionally distinct R-Ras) in response to receptor tyrosine kinase stimulation. Nucleotide exchange activity of Sos is stimulated by allosteric Ras binding. By another (separable) guanine exchange factor domain domain Sos modulates activity of Rac/Rho GTPases. Sos thus integrates signals that affect both gene expression and cytoskeletal reorganization; the Sos-mediated Ras-activation and Rac activation differ in composition and stability of the formed complex.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Peptide corresponding to amino acids THPSMHRDGPPLLENAHSS of human Sos protein.
Applications:
WB,ICC
Additional Info:
The antibody SOS-01 reacts with human Sos, an ubiquitously expressed 150 kDa intracellular protein.
Clone number:
SOS-01
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml; positive control: HeLa human cervix carcinoma cell line, reducing conditions.
SOCS3 (suppressor of cytokine signaling 3), also known as CIS3 (cytokine-inducible SH2 protein 3) is a negative regulator of particular cytokine signaling pathways. SOCS3 is induced by a variety of cytokines and other stimuli, such as erythropoietin, leptin and lipopolysaccharides and inhibits tyrosinkinase activity of JAK kinases, or e.g. JNK phosphorylation. SOCS3 modulates cytokine-mediated and neoplastic-proliferative responses and is involved also in maintaining leukocytes in quiescent state until antigen stimulation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Full-length SOCS3 protein.
Applications:
WB
Additional Info:
The antibody SO1 reacts with SOCS3, an intracellular cytokine signaling inhibitor.
Clone number:
SO1
Antibody Isotype:
IgG2b
Application Details:
Western blotting: Positive control: HeLa human cervix carcinoma cell line, reducing conditions.
SLP76 (SH2 domain-containing leukocyte protein of 76 kDa) is a cytosolic adaptor protein which translocates to the plasma mambrane and is involved in multiple signaling pathways in T cells, mast cells, neutrophils and platelets; B cells express its analog SLP65/BLNK (B cell linker protein). SLP76 is phosphorylated by Syk-family and Tec-family tyrosine kinases and couples them to the phosphorylation and activation of PLC-gamma. Via Gads or Grb2, SLP76 also associates with LAT adaptor by involvement of SLP76 proline-rich region. The SH2 domain of SLP76 has been identified as the region involved in binding the serine/threonine kinase HPK1. HPK1 may act as both a positive and a negative regulator by promoting the Jnk-mitogen activated protein kinase (MAPK) pathway and inhibiting the pathway leading to AP-1 activation.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed fusion protein representing amino acids 216-434 of human SLP76 with histidine tag
Applications:
WB,IHC
Additional Info:
The polyclonal antibody reacts with SLP76, a 76kDa cytosolic adaptor protein that is involved in signaling of various hematopoietic cells, such as T cells, mast cells or neutrophils; in B cells, however, it is replaced by SLP65.
Clone number:
PAb (412)
Application Details:
Western blotting: Positive control: JURKAT human T cell leukemia cell lysate, reducing conditions; Immunohistochemistry (paraffin sections): Recommended dilution: 10 ?g/ml, positive tissue: thymus.
SLP76 (SH2 domain-containing leukocyte protein of 76 kDa) is a cytosolic adaptor protein which translocates to the plasma mambrane and is involved in multiple signaling pathways in T cells, mast cells, neutrophils and platelets; B cells express its analog SLP65/BLNK (B cell linker protein). SLP76 is phosphorylated by Syk-family and Tec-family tyrosine kinases and couples them to the phosphorylation and activation of PLC-gamma. Via Gads or Grb2, SLP76 also associates with LAT adaptor by involvement of SLP76 proline-rich region. The SH2 domain of SLP76 has been identified as the region involved in binding the serine/threonine kinase HPK1. HPK1 may act as both a positive and a negative regulator by promoting the Jnk-mitogen activated protein kinase (MAPK) pathway and inhibiting the pathway leading to AP-1 activation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed fusion protein representing amino acids 216-434 of human SLP76 with histidine tag
Applications:
WB,IHC
Additional Info:
The monoclonal antibody reacts with SLP76, a 76kDa cytosolic adaptor protein that is involved in signaling of various hematopoietic cells, such as T cells, mast cells or neutrophils; in B cells, however, it is replaced by SLP65.
SIT (SHP2-interacting transmembrane adaptor protein) is expressed exclusively in lymphoid organs and acts either as a positive or as a negative regulatory element in T cell activation and in T cell development. Binding to Grb2 plays a pivotal role in signal transduction. Hubener et al. (2001) determined that the SIT gene contains 5 exons and spans 1.8 kb of genomic DNA. The SIT promoter demonstrated strong transcriptional activity and potential binding sites for both ubiquitous and lymphoid-specific transcription factors.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially produced recombinant intracellular fragment of human SIT.
Applications:
FC,IP,WB
Additional Info:
The antibody SIT-01 reacts with an intracellular epitope of SHP2-interacting transmembrane adaptor protein (SIT) expressed exclusively in lymphoid organs. It weakly crossreacts with murine SIT.
Clone number:
SIT-01
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Intracellular staining. Western blotting: SIT migrates as an approximately 40 kDa protein that is reduced to approximately 20 kDa by endoglycosidase treatment.
SIT (SHP2-interacting transmembrane adaptor protein) is expressed exclusively in lymphoid organs and acts either as a positive or as a negative regulatory element in T cell activation and in T cell development. Binding to Grb2 plays a pivotal role in signal transduction. Hubener et al. (2001) determined that the SIT gene contains 5 exons and spans 1.8 kb of genomic DNA. The SIT promoter demonstrated strong transcriptional activity and potential binding sites for both ubiquitous and lymphoid-specific transcription factors.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Bacterially produced recombinant intracellular fragment of human SIT.
Applications:
FC
Additional Info:
The antibody SIT-01 reacts with an intracellular epitope of SHP2-interacting transmembrane adaptor protein (SIT) expressed exclusively in lymphoid organs. It weakly crossreacts with murine SIT.
SHIP-1 (SH2 domain containing inositol phosphatase-1) is a 5´inositol phosphatase that regulates cell responses in lymphocytes and myeloid cells by hydrolyzing the second messenger PI(3,4,5) trisphosphate. SHIP-1 is recruited upon engagement of both inhibitory and activatory receptors, such as FcgammaRIIB, Fcgamma RIII, FcepsilonRI or cytokine and growth factor receptors, and supresses PI3K-dependent signaling, down-regulates cell migration and invasion of transformed cells and phagocytosis. SHIP-1 also serves as a scaffold for the recruitment of other proteins to the plasma membrane.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Peptide coresponding to a sequence within N-terminal domain of Human SHIP-1.
Applications:
FC,WB
Additional Info:
The antibody SHIP-01 reacts with SHIP-1, a phosphoinositide phosphatase largely confined to hematopoietic cells (intracellular antigen). Multiple forms of SHIP-1 have been reported with molecular weights of 110, 125, 130, 135 and 145 kDa.
Clone number:
SHIP-01
Antibody Isotype:
IgG2a
Application Details:
Flow cytometry: Intracellular staining; recommended dilution: 2-5 ?g/ml; positive control: human blood leukocytes. Western blotting: Positive control: RAMOS human cell line, reducing conditions.
SHIP-1 (SH2 domain containing inositol phosphatase-1) is a 5´inositol phosphatase that regulates cell responses in lymphocytes and myeloid cells by hydrolyzing the second messenger PI(3,4,5) trisphosphate. SHIP-1 is recruited upon engagement of both inhibitory and activatory receptors, such as FcgammaRIIB, Fcgamma RIII, FcepsilonRI or cytokine and growth factor receptors, and supresses PI3K-dependent signaling, down-regulates cell migration and invasion of transformed cells and phagocytosis. SHIP-1 also serves as a scaffold for the recruitment of other proteins to the plasma membrane.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Peptide coresponding to a sequence within N-terminal domain of Human SHIP-1.
Applications:
FC,WB
Additional Info:
The antibody SHIP-02 reacts with SHIP-1, a phosphoinositide phosphatase largely confined to hematopoietic cells. Multiple forms of SHIP-1 have been reported with molecular weights of 110, 125, 130, 135 and 145 kDa.
Clone number:
SHIP-02
Antibody Isotype:
IgG2a
Application Details:
Flow cytometry: Intracellular staining; recommended dilution: 2-5 ?g/ml; positive control: human blood leukocytes. Western blotting: Positive control: RAMOS human cell line, reducing conditions.
SCIMP (SLP adaptor and Csk interacting membrane protein), also known as Nvl, is a palmitoylated transmembrane adaptor protein expressed in professional antigen presenting cells, most prominently in the lymph nodes and spleen. It is associated with tetraspanin-enriched microdomains (together with MHC II). There is a close relationship between SCIMP and tyrosinkinase Lyn, which is constitutively bound to it by its SH3 domain. After MHC II-mediated stimulation in the immunological synapse SCIMP becomes phosphorylated at several tyrosine residues and provides docking sites for Grb2 and SLP65 or SLP76 adaptors transducing the signal downstream, as well as for the kinase Csk with modulatory roles.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant intracellular part of human SCIMP
Applications:
FC,IP,WB,ICC
Additional Info:
The mouse monoclonal antibody NVL-07 recognizes intracellular part of human transmembrane adaptor SCIMP. This protein of 17 kDa predicted Mw migrates as a 22 kDa band on SDS PAGE.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
TCR alpha/beta-negative CD3-positive rat T cell hybridoma III.89.1.4 line
Applications:
FA,FC,IP,IHC
Additional Info:
The mouse monoclonal antibody V65 recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
TCR alpha/beta-negative CD3-positive rat T cell hybridoma III.89.1.4 line
Applications:
FC,IP,IHC
Additional Info:
The mouse monoclonal antibody V65 recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
TCR alpha/beta-negative CD3-positive rat T cell hybridoma III.89.1.4 line
Applications:
FC
Additional Info:
The mouse monoclonal antibody V65 recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Rat T blasts and erythrocytes
Applications:
WB,IHC,ICC,FA,FC,IP
Additional Info:
The mouse monoclonal R73 recognizes an extracellular epitope TCR alpha/beta, the dominant subtype of T cell receptor expressed in peripheral blood.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Rat T blasts and erythrocytes
Applications:
FC,IP,WB,IHC,ICC
Additional Info:
The mouse monoclonal R73 recognizes an extracellular epitope TCR alpha/beta, the dominant subtype of T cell receptor expressed in peripheral blood.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Rat T blasts and erythrocytes
Applications:
FC
Additional Info:
The mouse monoclonal R73 recognizes an extracellular epitope TCR alpha/beta, the dominant subtype of T cell receptor expressed in peripheral blood.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Rat T blasts and erythrocytes
Applications:
FC
Additional Info:
The mouse monoclonal R73 recognizes an extracellular epitope TCR alpha/beta, the dominant subtype of T cell receptor expressed in peripheral blood.
PLSCR1 (phospholipid scramblase 1) is a multiply palmitoylated endofacial plasma membrane protein containing several SH3 and WW domain binding motives. In the plasma membrane, PLSCR1 plays a role in transbilayer lipid redistributions and signal transduction. Nonpalmitoylated PLSCR1, however, is able to be transported into the nucleus and bind DNA. PLSCR1 potentiates the antiviral activity of interferon and its expression is highly induced by interferons and growth factors.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Pooled lipid raft fraction isolated from RBL-2H3 cells
Applications:
IP,WB,ICC,FC
Additional Info:
The antibody 13A6 [TEC-23] binds to an intracellular epitope of rat Phospholipid Scramblase 1 (PLSCR1), an 37-49 kDa protein, accelerating bidirectional movement of plasma membrane phospholipids under conditions of elevated calcium.
Clone number:
13A6 [TEC-23]
Antibody Isotype:
IgG2a
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml, positive control: RBL (rat basophilic leukemia) cell line; both reducing and non-reducing conditions.Flow cytometry: Intracellular staining.
The CD8b (CD8 beta) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages, mast cells, and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
CD8 positive Wistar rat splenic T cell hybridomas
Applications:
FC,WB,FA,IP,IHC
Additional Info:
The mouse monoclonal antibody 341 (also known as 34.1) recognizes rat CD8b, the 32-34 kDa beta chain of the CD8 coreceptor (extracellular epitope), expressed on T cell subsets and some other cell types, such as macrophages.
The CD8b (CD8 beta) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages, mast cells, and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
CD8 positive Wistar rat splenic T cell hybridomas
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody 341 (also known as 34.1) recognizes rat CD8b, the 32-34 kDa beta chain of the CD8 coreceptor (extracellular epitope), expressed on T cell subsets and some other cell types, such as macrophages.
The CD8b (CD8 beta) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages, mast cells, and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
CD8 positive Wistar rat splenic T cell hybridomas
Applications:
FC
Additional Info:
The mouse monoclonal antibody 341 (also known as 34.1) recognizes rat CD8b, the 32-34 kDa beta chain of the CD8 coreceptor (extracellular epitope), expressed on T cell subsets and some other cell types, such as macrophages.
The CD8b (CD8 beta) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages, mast cells, and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
CD8 positive Wistar rat splenic T cell hybridomas
Applications:
FC
Additional Info:
The mouse monoclonal antibody 341 (also known as 34.1) recognizes rat CD8b, the 32-34 kDa beta chain of the CD8 coreceptor (extracellular epitope), expressed on T cell subsets and some other cell types, such as macrophages.
The CD8a (CD8 alpha) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
High Mw glycoproteins from rat thymocytes
Applications:
WB,IHC,FA,FC,IP
Additional Info:
The mouse monoclonal antibody OX-8 recognizes the hinge-like membrane-proximal extracellular domain of rat CD8a (32-34 kDa; alpha chain of the CD8 antigen).
The CD8a (CD8 alpha) subunit of CD8 T cell coreceptor is expressed in CD8 alpha/beta heterodimers on majority of MHC I-restricted conventional T cells and thymocytes and in CD8 alpha/alpha homodimers on subsets of memory T cells, intraepithelial lymphocytes, NK cells, macrophages and dendritic cells. Regulation of CD8 beta level on T cell surface seems to be an important mechanism to control their effector function. Assembly of CD8 alpha/beta but not alpha/alpha dimers is connected with formation or localization to the lipid rafts. Recruiting triggered TCR complexes to these membrane microdomains as well as affinity of TCR to MHC I is modulated by CD8, thereby affecting the functional diversity of the TCR signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
High Mw glycoproteins from rat thymocytes
Applications:
FC,IP,WB,IHC
Additional Info:
The mouse monoclonal antibody OX-8 recognizes the hinge-like membrane-proximal extracellular domain of rat CD8a (32-34 kDa; alpha chain of the CD8 antigen).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
MLR generated rat Th cells
Applications:
FC,IHC,ICC
Additional Info:
The mouse monoclonal antibody OX-35 reacts with an extracellular epitope of rat CD4 transmembrane glycoprotein (55 kDa).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
MLR generated rat Th cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody OX-35 reacts with an extracellular epitope of rat CD4 transmembrane glycoprotein (55 kDa).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
MLR generated rat Th cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody OX-35 reacts with an extracellular epitope of rat CD4 transmembrane glycoprotein (55 kDa).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
MLR generated rat Th cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody OX-35 reacts with an extracellular epitope of rat CD4 transmembrane glycoprotein (55 kDa).
CD28 is the critical T cell costimulatory receptor which provides to the cell the important second activation signal by binding CD80 and CD86 that are expressed by antigen presenting cells. Besides its costimulation role CD28 functions in preventing T cells from anergic hyporesponsive state or from undergoing premature apoptotic cell death. CD28 is also expressed on human fetal NK cells and some NK cell lines, whereas on murine NK cells the CD28 expression is much broader.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse A20J B lymphoma cells transfected with rat CD28
Applications:
FA,FC,IP
Additional Info:
The mouse monoclonal antibody JJ319 reacts with an extracellular epitope of CD28, a disulfide-linked homodimeric type I glycoprotein (monomer of Mw 44 kDa) which is a critical costimulatory receptor of T cells.
CD28 is the critical T cell costimulatory receptor which provides to the cell the important second activation signal by binding CD80 and CD86 that are expressed by antigen presenting cells. Besides its costimulation role CD28 functions in preventing T cells from anergic hyporesponsive state or from undergoing premature apoptotic cell death. CD28 is also expressed on human fetal NK cells and some NK cell lines, whereas on murine NK cells the CD28 expression is much broader.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse A20J B lymphoma cells transfected with rat CD28
Applications:
FC,IP
Additional Info:
The mouse monoclonal antibody JJ319 reacts with an extracellular epitope of CD28, a disulfide-linked homodimeric type I glycoprotein (monomer of Mw 44 kDa) which is a critical costimulatory receptor of T cells.
CD28 is the critical T cell costimulatory receptor which provides to the cell the important second activation signal by binding CD80 and CD86 that are expressed by antigen presenting cells. Besides its costimulation role CD28 functions in preventing T cells from anergic hyporesponsive state or from undergoing premature apoptotic cell death. CD28 is also expressed on human fetal NK cells and some NK cell lines, whereas on murine NK cells the CD28 expression is much broader.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse A20J B lymphoma cells transfected with rat CD28
Applications:
FC
Additional Info:
The mouse monoclonal antibody JJ319 reacts with an extracellular epitope of CD28, a disulfide-linked homodimeric type I glycoprotein (monomer of Mw 44 kDa) which is a critical costimulatory receptor of T cells.
CD28 is the critical T cell costimulatory receptor which provides to the cell the important second activation signal by binding CD80 and CD86 that are expressed by antigen presenting cells. Besides its costimulation role CD28 functions in preventing T cells from anergic hyporesponsive state or from undergoing premature apoptotic cell death. CD28 is also expressed on human fetal NK cells and some NK cell lines, whereas on murine NK cells the CD28 expression is much broader.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse A20J B lymphoma cells transfected with rat CD28
Applications:
FC
Additional Info:
The mouse monoclonal antibody JJ319 reacts with an extracellular epitope of CD28, a disulfide-linked homodimeric type I glycoprotein (monomer of Mw 44 kDa) which is a critical costimulatory receptor of T cells.
CD161, also known as Nkrp1 (natural killer receptor protein 1) or Klrb1 (killer cell lectin-like receptor subfamily b member 1), is a disulphide-linked homodimeric receptor, which is involved in regulation of NK cell and NKT cell function. It is expressed on rat NK cells, subset of T cells, dendritic cells, and activated monocytes. Although human CD161 is expressed as one isoform, the rat CD161 has three isoforms, referred to as CD161a, b, and c. These proteins contain C-terminal C-type lectin extracellular domain, a transmembrane domain, and N-terminal intracellular domain, which contains ITIM motif, such as CD161b, and displays inhibitory function, or does not contain ITIM motif, thus also not the inhibitory function, such as CD161a.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Splenic cells purified from the LEW rat
Applications:
FC,IP,WB,IHC,RIA
Additional Info:
The mouse monoclonal antibody 10/78 recognizes CD161, an approximately 30 kDa type II transmembrane C-type lectin receptor, expressed on the plasma membrane of NK cells, dendritic cells, activated monocytes and a subset of T cells as a disulphide-linked homodimer. A common extracellular epitope on rat CD161a and b isoforms is detected.
CD161, also known as Nkrp1 (natural killer receptor protein 1) or Klrb1 (killer cell lectin-like receptor subfamily b member 1), is a disulphide-linked homodimeric receptor, which is involved in regulation of NK cell and NKT cell function. It is expressed on rat NK cells, subset of T cells, dendritic cells, and activated monocytes. Although human CD161 is expressed as one isoform, the rat CD161 has three isoforms, referred to as CD161a, b, and c. These proteins contain C-terminal C-type lectin extracellular domain, a transmembrane domain, and N-terminal intracellular domain, which contains ITIM motif, such as CD161b, and displays inhibitory function, or does not contain ITIM motif, thus also not the inhibitory function, such as CD161a.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Splenic cells purified from the LEW rat
Applications:
FC
Additional Info:
The mouse monoclonal antibody 10/78 recognizes CD161, an approximately 30 kDa type II transmembrane C-type lectin receptor, expressed on the plasma membrane of NK cells, dendritic cells, activated monocytes and a subset of T cells as a disulphide-linked homodimer. A common extracellular epitope on rat CD161a and b isoforms is detected.
CD161, also known as Nkrp1 (natural killer receptor protein 1) or Klrb1 (killer cell lectin-like receptor subfamily b member 1), is a disulphide-linked homodimeric receptor, which is involved in regulation of NK cell and NKT cell function. It is expressed on rat NK cells, subset of T cells, dendritic cells, and activated monocytes. Although human CD161 is expressed as one isoform, the rat CD161 has three isoforms, referred to as CD161a, b, and c. These proteins contain C-terminal C-type lectin extracellular domain, a transmembrane domain, and N-terminal intracellular domain, which contains ITIM motif, such as CD161b, and displays inhibitory function, or does not contain ITIM motif, thus also not the inhibitory function, such as CD161a.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Splenic cells purified from the LEW rat
Applications:
FC
Additional Info:
The mouse monoclonal antibody 10/78 recognizes CD161, an approximately 30 kDa type II transmembrane C-type lectin receptor, expressed on the plasma membrane of NK cells, dendritic cells, activated monocytes and a subset of T cells as a disulphide-linked homodimer. A common extracellular epitope on rat CD161a and b isoforms is detected.
R-Ras2 / TC21 is the only member of R-Ras family of small GTPases that shows transforming activities similar to H-Ras, N-Ras, and K-Ras, and it is also structurally similar to them. R-Ras2 seems to play an important role in activating signal transduction pathways that control cell proliferation. Its mutations are associated with the growth of certain tumors, but also overexpression of the wild type form of R-Ras2 has been frequently detected in various carcinomas. Pseudogenes of R-Ras2 gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human TC21
Applications:
FC,WB,ELISA,ICC
Additional Info:
The mouse monoclonal antibody EM-50 recognizes R-Ras2 / TC21 protein (intracellular antigen) and does not react with R-Ras1, H-Ras, K-Ras, and N-Ras.
R-Ras2 / TC21 is the only member of R-Ras family of small GTPases that shows transforming activities similar to H-Ras, N-Ras, and K-Ras, and it is also structurally similar to them. R-Ras2 seems to play an important role in activating signal transduction pathways that control cell proliferation. Its mutations are associated with the growth of certain tumors, but also overexpression of the wild type form of R-Ras2 has been frequently detected in various carcinomas. Pseudogenes of R-Ras2 gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Human TC21
Applications:
FC
Additional Info:
The mouse monoclonal antibody EM-50 recognizes R-Ras2 / TC21 protein (intracellular antigen) and does not react with R-Ras1, H-Ras, K-Ras, and N-Ras.
Ribosomal protein SA (RPSA) is a multi-functional protein, that is an important component of 40S ribosomal subunit, and binds to lamin. Higher expression of RPSA is characteristic for many carcinomas, and correlates with their invasivity and metastatic potential. It has also been described, that RPSA interacts with amyloid beta peptide during Alzheimer´s disease.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
REPRLLVVTDPRADHQP
Applications:
WB,IHC,ICC,ELISA,IP,FC
Additional Info:
The mouse monoclonal antibody RP-01 recognizes ribosomal protein SA (RPSA), which is important for formation and stability of 40S ribosomal subunit, and is overexpressed in many carcinomas.
RLTPR / CARMIL2 (RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing; capping protein regulator and myosin 1 linker 2), also known as LRRC16C, is a cytosolic protein, which with high affinity binds CAPZA2 (capping protein muscle actin Z-line alpha 2) and decreases CAPZA2 affinity for actin barbed ends. RLTPR / CARMIL2 increases the rate of actin filament elongation from seeds in the presence of CAPZA2, however, seems unable to nucleate filaments. Its interaction with CAPZA2 is essential for lamellipodial protrusion and cell translocation. RLTPR / CARMIL2 is crutial for T cell costimulation via CD28 and this property seems to be independent on its actin-uncapping function. The lack of functional RLTPR / CARMIL2 molecules impeded the differentiation toward Th1 and Th17 fates of both human and murine CD4+ T cells and leads to combined immunodeficiency. Expression of RLTPR / CARMIL2 was also detected in human and murine B cells, but it seems not to be involved in BCR-mediated signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine RLTPR
Applications:
FC,WB
Additional Info:
The mouse monoclonal antibody EM-53 recognizes RLTPR / CARMIL2, an intracellular protein playing a role in actin filament elongation.
RLTPR / CARMIL2 (RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing; capping protein regulator and myosin 1 linker 2), also known as LRRC16C, is a cytosolic protein, which with high affinity binds CAPZA2 (capping protein muscle actin Z-line alpha 2) and decreases CAPZA2 affinity for actin barbed ends. RLTPR / CARMIL2 increases the rate of actin filament elongation from seeds in the presence of CAPZA2, however, seems unable to nucleate filaments. Its interaction with CAPZA2 is essential for lamellipodial protrusion and cell translocation. RLTPR / CARMIL2 is crutial for T cell costimulation via CD28 and this property seems to be independent on its actin-uncapping function. The lack of functional RLTPR / CARMIL2 molecules impeded the differentiation toward Th1 and Th17 fates of both human and murine CD4+ T cells and leads to combined immunodeficiency. Expression of RLTPR / CARMIL2 was also detected in human and murine B cells, but it seems not to be involved in BCR-mediated signaling.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine RLTPR
Applications:
FC
Additional Info:
The mouse monoclonal antibody EM-53 recognizes RLTPR / CARMIL2, an intracellular protein playing a role in actin filament elongation.
CD80 (B7-1) and CD86 (B7-2) are ligands of T cell critical costimulatory molecule CD28 and of an inhibitory receptor CTLA-4 (CD152). The both B7 molecules are expressed on professional antigen-presenting cells and are essential for T cell activation, the both molecules can also substitute for each other in this process. The question what are the differences in CD80 and CD86 competency has not been fully elucidated yet; there are still conflicts in results about their respective roles in initiation or sustaining of the T cell immune response.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
CD80-transfected CHO cell line
Applications:
IHC,IP,FC,FA
Additional Info:
The Armenian hamster monoclonal antibody 16-10A1 reacts with an extracellular epitope of CD80 (B7-1), a 60 kDa single chain type I glycoprotein of immunoglobulin supergene family, expressed on professional antigen-presenting cells, such as dendritic cells, macrophages or activated B lymphocytes.
CD80 (B7-1) and CD86 (B7-2) are ligands of T cell critical costimulatory molecule CD28 and of an inhibitory receptor CTLA-4 (CD152). The both B7 molecules are expressed on professional antigen-presenting cells and are essential for T cell activation, the both molecules can also substitute for each other in this process. The question what are the differences in CD80 and CD86 competency has not been fully elucidated yet; there are still conflicts in results about their respective roles in initiation or sustaining of the T cell immune response.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
CD80-transfected CHO cell line
Applications:
FC,IP,IHC
Additional Info:
The Armenian hamster monoclonal antibody 16-10A1 reacts with an extracellular epitope of CD80 (B7-1), a 60 kDa single chain type I glycoprotein of immunoglobulin supergene family, expressed on professional antigen-presenting cells, such as dendritic cells, macrophages or activated B lymphocytes.
CD62L (L-selectin) is an adhesion glycoprotein that is constitutively expressed on the cell surface of leukocytes and mediates their homing to inflammatory sites and peripheral lymph nodes by enabling rolling along the venular wall. CD62L is also involved in activation-induced neutrophil aggregation. Activation-dependent CD62L shedding, however, counteracts neutrophil rolling. CD62L has also signaling roles including enhance of chemokine receptor expression. Similarly to CD62P, the major ligand of CD62L is PSGL-1 (P-selectin glycoprotein ligand-1).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C3H/eb mouse B cell lymphoma 38C-13
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody MEL-14 reacts with an extracellular epitope of murine CD62L (L-selectin), a 75 kDa single chain type I glycoprotein expressed on most peripheral blood B lymphocytes, T lymphocytes, monocytes and granulocytes; it is also present on a subset of NK cells and certain hematopoietic malignant cells.
CD62L (L-selectin) is an adhesion glycoprotein that is constitutively expressed on the cell surface of leukocytes and mediates their homing to inflammatory sites and peripheral lymph nodes by enabling rolling along the venular wall. CD62L is also involved in activation-induced neutrophil aggregation. Activation-dependent CD62L shedding, however, counteracts neutrophil rolling. CD62L has also signaling roles including enhance of chemokine receptor expression. Similarly to CD62P, the major ligand of CD62L is PSGL-1 (P-selectin glycoprotein ligand-1).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C3H/eb mouse B cell lymphoma 38C-13
Applications:
FC,IP,IHC,ICC
Additional Info:
The rat monoclonal antibody MEL-14 reacts with an extracellular epitope of murine CD62L (L-selectin), a 75 kDa single chain type I glycoprotein expressed on most peripheral blood B lymphocytes, T lymphocytes, monocytes and granulocytes; it is also present on a subset of NK cells and certain hematopoietic malignant cells.
CD62L (L-selectin) is an adhesion glycoprotein that is constitutively expressed on the cell surface of leukocytes and mediates their homing to inflammatory sites and peripheral lymph nodes by enabling rolling along the venular wall. CD62L is also involved in activation-induced neutrophil aggregation. Activation-dependent CD62L shedding, however, counteracts neutrophil rolling. CD62L has also signaling roles including enhance of chemokine receptor expression. Similarly to CD62P, the major ligand of CD62L is PSGL-1 (P-selectin glycoprotein ligand-1).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
C3H/eb mouse B cell lymphoma 38C-13
Applications:
FC
Additional Info:
The rat monoclonal antibody MEL-14 reacts with an extracellular epitope of murine CD62L (L-selectin), a 75 kDa single chain type I glycoprotein expressed on most peripheral blood B lymphocytes, T lymphocytes, monocytes and granulocytes; it is also present on a subset of NK cells and certain hematopoietic malignant cells.
CD5 antigen (T1; 67 kDa) is a human cell surface T-lymphocyte single-chain transmembrane glycoprotein. CD5 is expressed on all mature T-lymphocytes, most of thymocytes, subset of B-lymphocytes and on many T-cell leukemias and lymphomas. It is a type I membrane glycoprotein whose extracellular region contains three scavenger receptor cysteine-rich (SRCR) domains. The CD5 is a signal transducing molecule whose cytoplasmic tail is devoid of any intrinsic catalytic activity. CD5 modulates signaling through the antigen-specific receptor complex (TCR and BCR). CD5 crosslinking induces extracellular Ca++ mobilization, tyrosine phosphorylation of intracellular proteins and DAG production. Preliminary evidence shows protein associations with ZAP-70, p56lck, p59fyn, PC-PLC, etc. CD5 may serve as a dual receptor, giving either stimulatory or inhibitory signals depending both on the cell type and development stage. In thymocytes and B1a cells it seems to provide inhibitory signals, in peripheral mature T lymhocytes it acts as a costimulatory signal receptor. CD5 is the phenotypic marker of a B cell subpopulation involved in the production of autoreactive antibodies. Disease relevance: CD5 is a phenotypic marker for some B cell lymphoproliferative disorders (B-CLL, Hairy cell leukemia, etc.). The CD5+ popuation is expanded in some autoimmune disorders (rheumatoid arthritis, etc.). Herpes virus infections induce loss of CD5 expression in the expanded CD8+ human T cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
murine thymus or spleen cells
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody 53-7.3 recognizes an extracellular epitope of CD5, a 67kDa single-chain transmembrane glycoprotein expressed on mature T lymphocytes, most of thymocytes and B-1 lymphocytes.
CD5 antigen (T1; 67 kDa) is a human cell surface T-lymphocyte single-chain transmembrane glycoprotein. CD5 is expressed on all mature T-lymphocytes, most of thymocytes, subset of B-lymphocytes and on many T-cell leukemias and lymphomas. It is a type I membrane glycoprotein whose extracellular region contains three scavenger receptor cysteine-rich (SRCR) domains. The CD5 is a signal transducing molecule whose cytoplasmic tail is devoid of any intrinsic catalytic activity. CD5 modulates signaling through the antigen-specific receptor complex (TCR and BCR). CD5 crosslinking induces extracellular Ca++ mobilization, tyrosine phosphorylation of intracellular proteins and DAG production. Preliminary evidence shows protein associations with ZAP-70, p56lck, p59fyn, PC-PLC, etc. CD5 may serve as a dual receptor, giving either stimulatory or inhibitory signals depending both on the cell type and development stage. In thymocytes and B1a cells it seems to provide inhibitory signals, in peripheral mature T lymhocytes it acts as a costimulatory signal receptor. CD5 is the phenotypic marker of a B cell subpopulation involved in the production of autoreactive antibodies. Disease relevance: CD5 is a phenotypic marker for some B cell lymphoproliferative disorders (B-CLL, Hairy cell leukemia, etc.). The CD5+ popuation is expanded in some autoimmune disorders (rheumatoid arthritis, etc.). Herpes virus infections induce loss of CD5 expression in the expanded CD8+ human T cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
murine thymus or spleen cells
Applications:
FC
Additional Info:
The rat monoclonal antibody 53-7.3 recognizes an extracellular epitope of CD5, a 67kDa single-chain transmembrane glycoprotein expressed on mature T lymphocytes, most of thymocytes and B-1 lymphocytes.
CD49e, the alpha 5 integrin, noncovalently associates with the beta 1integrin (CD29) to form VLA-5 integrin complex. CD49e itself is composed of two disulfide-linked chains of 135 kDa and 25 kDa. VLA-5 binds to RGD sequence of fibronectin, and to neural adhesion molecule L1. It is important in maintaining the integrity of endothelial monolayers, in monocyte migration into the extracellular tissues, and it also provides a co-stimulatory signal to T cells and enhances receptor and complement receptor-mediated phagocytosis.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C57BL/6 x A/J)F1 murine mast cell line
Applications:
ICC,FA,FC,IHC
Additional Info:
The rat monoclonal antibody 5H10-27 (MFR5) recognizes an extracellular epitope of murine CD49e, a 135 kDa protein serving as VLA-5 alpha chain, expressed on thymocytes, activated T cells, splenic B cells, and mast cells.
CD49e, the alpha 5 integrin, noncovalently associates with the beta 1integrin (CD29) to form VLA-5 integrin complex. CD49e itself is composed of two disulfide-linked chains of 135 kDa and 25 kDa. VLA-5 binds to RGD sequence of fibronectin, and to neural adhesion molecule L1. It is important in maintaining the integrity of endothelial monolayers, in monocyte migration into the extracellular tissues, and it also provides a co-stimulatory signal to T cells and enhances receptor and complement receptor-mediated phagocytosis.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C57BL/6 x A/J)F1 murine mast cell line
Applications:
ICC,FC,IHC
Additional Info:
The rat monoclonal antibody 5H10-27 (MFR5) recognizes an extracellular epitope of murine CD49e, a 135 kDa protein serving as VLA-5 alpha chain, expressed on thymocytes, activated T cells, splenic B cells, and mast cells.
CD49e, the alpha 5 integrin, noncovalently associates with the beta 1integrin (CD29) to form VLA-5 integrin complex. CD49e itself is composed of two disulfide-linked chains of 135 kDa and 25 kDa. VLA-5 binds to RGD sequence of fibronectin, and to neural adhesion molecule L1. It is important in maintaining the integrity of endothelial monolayers, in monocyte migration into the extracellular tissues, and it also provides a co-stimulatory signal to T cells and enhances receptor and complement receptor-mediated phagocytosis.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
C57BL/6 x A/J)F1 murine mast cell line
Applications:
FC
Additional Info:
The rat monoclonal antibody 5H10-27 (MFR5) recognizes an extracellular epitope of murine CD49e, a 135 kDa protein serving as VLA-5 alpha chain, expressed on thymocytes, activated T cells, splenic B cells, and mast cells.
CD49e, the alpha 5 integrin, noncovalently associates with the beta 1integrin (CD29) to form VLA-5 integrin complex. CD49e itself is composed of two disulfide-linked chains of 135 kDa and 25 kDa. VLA-5 binds to RGD sequence of fibronectin, and to neural adhesion molecule L1. It is important in maintaining the integrity of endothelial monolayers, in monocyte migration into the extracellular tissues, and it also provides a co-stimulatory signal to T cells and enhances receptor and complement receptor-mediated phagocytosis.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
C57BL/6 x A/J)F1 murine mast cell line
Applications:
FC
Additional Info:
The rat monoclonal antibody 5H10-27 (MFR5) recognizes an extracellular epitope of murine CD49e, a 135 kDa protein serving as VLA-5 alpha chain, expressed on thymocytes, activated T cells, splenic B cells, and mast cells.
CD49d (integrin alpha 4), also known as very late antigen 4 alpha (VLA-4 alpha) is a cell surface glycoprotein constituting integrin complexes. CD49d heterodimerizes with CD29 (integrin beta 1) to form VLA-4 antigen, which is involved in cell-cell and cell-extracellular matrix interactions, which is a receptor for CD106 (VCAM) and fibronectin. CD79d also heterodimerizes with integrin beta 7 to form LPAM-1, which binds to MAdCAM-1 (mucosal vascular addressin). These interactions are important for cell adhesion and activation.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
murine T lymphoma line TK1
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody R1-2 recognizes an extracellular epitope of murine CD49d / Integrin alpha 4 (VLA-4 alpha), an approximately 150 kDa glycoprotein of the integrin family, expressed on multiple blood cell types.
CD49d (integrin alpha 4), also known as very late antigen 4 alpha (VLA-4 alpha) is a cell surface glycoprotein constituting integrin complexes. CD49d heterodimerizes with CD29 (integrin beta 1) to form VLA-4 antigen, which is involved in cell-cell and cell-extracellular matrix interactions, which is a receptor for CD106 (VCAM) and fibronectin. CD79d also heterodimerizes with integrin beta 7 to form LPAM-1, which binds to MAdCAM-1 (mucosal vascular addressin). These interactions are important for cell adhesion and activation.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
murine T lymphoma line TK1
Applications:
FC
Additional Info:
The rat monoclonal antibody R1-2 recognizes an extracellular epitope of murine CD49d / Integrin alpha 4 (VLA-4 alpha), an approximately 150 kDa glycoprotein of the integrin family, expressed on multiple blood cell types.
CD45R, also known as B220, is a receptor-type protein tyrosine phosphatase glycoprotein. It is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases, promotes cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis. CD45R expression also identifies a subset of murine bone marrow cells able to form osteoclast-like cells.
The rat monoclonal antibody RA3-6B2 recognizes an extracellular epitope on CD45R, which is expressed at all developmental stages of B cells, including activated B cells, but also on subsets of NK and T cells. T cells detected by this antibody are supposed to be in activated state.
Clone number:
RA3-6B2
Antibody Isotype:
IgG2a k
Application Details:
Functional application: Modulation of B cell responses. Flow cytometry: Recommended dilution: 1-4 µg/ml
CD45R, also known as B220, is a receptor-type protein tyrosine phosphatase glycoprotein. It is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases, promotes cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis. CD45R expression also identifies a subset of murine bone marrow cells able to form osteoclast-like cells.
The rat monoclonal antibody RA3-6B2 recognizes an extracellular epitope on CD45R, which is expressed at all developmental stages of B cells, including activated B cells, but also on subsets of NK and T cells. T cells detected by this antibody are supposed to be in activated state.
CD45R, also known as B220, is a receptor-type protein tyrosine phosphatase glycoprotein. It is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases, promotes cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis. CD45R expression also identifies a subset of murine bone marrow cells able to form osteoclast-like cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The rat monoclonal antibody RA3-6B2 recognizes an extracellular epitope on CD45R, which is expressed at all developmental stages of B cells, including activated B cells, but also on subsets of NK and T cells. T cells detected by this antibody are supposed to be in activated state.
CD45R, also known as B220, is a receptor-type protein tyrosine phosphatase glycoprotein. It is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases, promotes cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis. CD45R expression also identifies a subset of murine bone marrow cells able to form osteoclast-like cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The rat monoclonal antibody RA3-6B2 recognizes an extracellular epitope on CD45R, which is expressed at all developmental stages of B cells, including activated B cells, but also on subsets of NK and T cells. T cells detected by this antibody are supposed to be in activated state.
CD45R, also known as B220, is a receptor-type protein tyrosine phosphatase glycoprotein. It is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases, promotes cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis. CD45R expression also identifies a subset of murine bone marrow cells able to form osteoclast-like cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The rat monoclonal antibody RA3-6B2 recognizes an extracellular epitope on CD45R, which is expressed at all developmental stages of B cells, including activated B cells, but also on subsets of NK and T cells. T cells detected by this antibody are supposed to be in activated state.
CD45 (LCA, leukocyte common antigen) is a receptor-type protein tyrosine phosphatase ubiquitously expressed in all nucleated hematopoietic cells, comprising approximately 10% of all surface proteins in lymphocytes. CD45 glycoprotein is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases. CD45 protein exists as multiple isoforms as a result of alternative splicing; these isoforms differ in their extracellular domains, whereas they share identical transmembrane and cytoplasmic domains. These isoforms differ in their ability to translocate into the glycosphingolipid-enriched membrane domains and their expression depends on cell type and physiological state of the cell. Besides the role in immunoreceptor signaling, CD45 is important in promoting cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine peripheral blood leukocytes
Applications:
FC,IP,WB,ICC
Additional Info:
The rat monoclonal antibody EM-05 reacts with an extracellular epitope of murine CD45 antigen (Leukocyte Common Antigen), a single chain type I transmembrane protein expressed at high level on cells of hematopoietic origin, except erythrocytes and platelets.
CD45 (LCA, leukocyte common antigen) is a receptor-type protein tyrosine phosphatase ubiquitously expressed in all nucleated hematopoietic cells, comprising approximately 10% of all surface proteins in lymphocytes. CD45 glycoprotein is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases. CD45 protein exists as multiple isoforms as a result of alternative splicing; these isoforms differ in their extracellular domains, whereas they share identical transmembrane and cytoplasmic domains. These isoforms differ in their ability to translocate into the glycosphingolipid-enriched membrane domains and their expression depends on cell type and physiological state of the cell. Besides the role in immunoreceptor signaling, CD45 is important in promoting cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine peripheral blood leukocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody EM-05 reacts with an extracellular epitope of murine CD45 antigen (Leukocyte Common Antigen), a single chain type I transmembrane protein expressed at high level on cells of hematopoietic origin, except erythrocytes and platelets.
CD45 (LCA, leukocyte common antigen) is a receptor-type protein tyrosine phosphatase ubiquitously expressed in all nucleated hematopoietic cells, comprising approximately 10% of all surface proteins in lymphocytes. CD45 glycoprotein is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases. CD45 protein exists as multiple isoforms as a result of alternative splicing; these isoforms differ in their extracellular domains, whereas they share identical transmembrane and cytoplasmic domains. These isoforms differ in their ability to translocate into the glycosphingolipid-enriched membrane domains and their expression depends on cell type and physiological state of the cell. Besides the role in immunoreceptor signaling, CD45 is important in promoting cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine peripheral blood leukocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody EM-05 reacts with an extracellular epitope of murine CD45 antigen (Leukocyte Common Antigen), a single chain type I transmembrane protein expressed at high level on cells of hematopoietic origin, except erythrocytes and platelets.
CD45 (LCA, leukocyte common antigen) is a receptor-type protein tyrosine phosphatase ubiquitously expressed in all nucleated hematopoietic cells, comprising approximately 10% of all surface proteins in lymphocytes. CD45 glycoprotein is crucial in lymphocyte development and antigen signaling, serving as an important regulator of Src-family kinases. CD45 protein exists as multiple isoforms as a result of alternative splicing; these isoforms differ in their extracellular domains, whereas they share identical transmembrane and cytoplasmic domains. These isoforms differ in their ability to translocate into the glycosphingolipid-enriched membrane domains and their expression depends on cell type and physiological state of the cell. Besides the role in immunoreceptor signaling, CD45 is important in promoting cell survival by modulating integrin-mediated signal transduction pathway and is also involved in DNA fragmentation during apoptosis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine peripheral blood leukocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody EM-05 reacts with an extracellular epitope of murine CD45 antigen (Leukocyte Common Antigen), a single chain type I transmembrane protein expressed at high level on cells of hematopoietic origin, except erythrocytes and platelets.
CD41 (platelet glycoprotein IIb) is composed of two subunits (120 kDa a, alpha and 23 kDa b, beta) that interact with CD61 in the presence of calcium to form a functional adhesive protein receptor. Upon blood vessel damage, this receptor binds to a variety of proteins including von Willebrand factor, fibrinogen, fibronectin and vitronectin. CD41 is mainly expressed on megakaryocyte-platelet lineage, but generally belongs to the antigens that are expressed during early stages of hematopoietic differentiation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine platelets
Applications:
FC,IP,IHC,ELISA,FA
Additional Info:
The rat monoclonal antibody MWReg30 recognizes an extracellular epitope of CD41 (GPIIb), a transmembrane glycoprotein (integrin family) composed of two chains GPIIb alpha (heavy chain; 120 kDa) and GPIIb beta (light chain; 23 kDa). CD41 is mainly expressed on platelets and megakaryocytes.
CD41 (platelet glycoprotein IIb) is composed of two subunits (120 kDa a, alpha and 23 kDa b, beta) that interact with CD61 in the presence of calcium to form a functional adhesive protein receptor. Upon blood vessel damage, this receptor binds to a variety of proteins including von Willebrand factor, fibrinogen, fibronectin and vitronectin. CD41 is mainly expressed on megakaryocyte-platelet lineage, but generally belongs to the antigens that are expressed during early stages of hematopoietic differentiation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine platelets
Applications:
FC,IP,IHC,ELISA
Additional Info:
The rat monoclonal antibody MWReg30 recognizes an extracellular epitope of CD41 (GPIIb), a transmembrane glycoprotein (integrin family) composed of two chains GPIIb alpha (heavy chain; 120 kDa) and GPIIb beta (light chain; 23 kDa). CD41 is mainly expressed on platelets and megakaryocytes.
CD41 (platelet glycoprotein IIb) is composed of two subunits (120 kDa a, alpha and 23 kDa b, beta) that interact with CD61 in the presence of calcium to form a functional adhesive protein receptor. Upon blood vessel damage, this receptor binds to a variety of proteins including von Willebrand factor, fibrinogen, fibronectin and vitronectin. CD41 is mainly expressed on megakaryocyte-platelet lineage, but generally belongs to the antigens that are expressed during early stages of hematopoietic differentiation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine platelets
Applications:
FC
Additional Info:
The rat monoclonal antibody MWReg30 recognizes an extracellular epitope of CD41 (GPIIb), a transmembrane glycoprotein (integrin family) composed of two chains GPIIb alpha (heavy chain; 120 kDa) and GPIIb beta (light chain; 23 kDa). CD41 is mainly expressed on platelets and megakaryocytes.
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
Clone number:
GK1.5
Antibody Isotype:
IgG2b
Application Details:
Functional application: Isolation and depletion of CD4+ T cells, blocking of ligand binding to CD4. Immunocytochemistry: Recommended dilution: 1-4 ?g/ml. Immunoprecipitation: Recommended dilution: 1-2 ?g / 100-500 ?g of protein in 1 ml lysate. Flow cytometry: Recommended dilution: 1 ?g/million cells.
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
Clone number:
GK1.5
Antibody Isotype:
IgG2b
Application Details:
Functional application: Isolation and depletion of CD4+ T cells, blocking of ligand binding to CD4. Immunocytochemistry: Recommended dilution: 1-4 ?g/ml. Immunoprecipitation: Recommended dilution: 1-2 ?g / 100-500 ?g of protein in 1 ml lysate. Flow cytometry: Recommended dilution: 1 ?g/million cells. Immunohistochemistry: Recommended dilution: 5-10 ?g/ml.
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC,IP,IHC,ICC
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
Clone number:
GK1.5
Antibody Isotype:
IgG2b
Application Details:
Immunocytochemistry: Recommended dilution: 1-4 ?g/ml. Immunoprecipitation: Recommended dilution: 1-2 ?g / 100-500 ?g of protein in 1 ml lysate. Flow cytometry: Recommended dilution: 1 ?g/million cells.
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
CD4 (T4) is a single chain transmembrane glycoprotein and belongs to immunoglobulin supergene family. In extracellular region there are 4 immunoglobulin-like domains (1 Ig-like V-type and 3 Ig-like C2-type). Transmembrane region forms 25 aa, cytoplasmic tail consists of 38 aa. Domains 1,2 and 4 are stabilized by disulfide bonds. The intracellular domain of CD4 is associated with p56Lck, a Src-like protein tyrosine kinase. It was described that CD4 segregates into specific detergent-resistant T-cell membrane microdomains. Extracellular ligands: MHC class II molecules (binds to CDR2-like region in CD4 domain 1); HIV envelope protein gp120 (binds to CDR2-like region in CD4 domain 1); IL-16 (binds to CD4 domain 3), human seminal plasma glycoprotein gp17 (binds to CD4 domain 1), L-selectin. Intracellular ligands: p56LckCD4 is a co-receptor involved in immune response (co-receptor activity in binding to MHC class II molecules) and HIV infection (human immunodeficiency virus; CD4 is primary receptor for HIV-1 surface glycoprotein gp120). CD4 regulates T-cell activation, T/B-cell adhesion, T-cell diferentiation, T-cell selection and signal transduction. Defects in antigen presentation (MHC class II) cause dysfunction of CD4+ T-cells and their almost complete absence in patients blood, tissue and organs (SCID immunodeficiency).
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse CTL clone V4 cells
Applications:
FC
Additional Info:
The rat monoclonal antibody GK1.5 reacts with an extracellular epitope of mouse CD4 transmembrane glycoprotein (55 kDa).
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
Clone number:
145-2C11
Antibody Isotype:
IgG k
Application Details:
Functional application: Induction of T cell activation, proliferation or apoptosis (depending on conditions), in vivo T cell depletion. Flow cytometry: Recommended dilution: 1-2 ?g / ml (million cells). Immunoprecipitation: Recommended dilution: 1-2 ?g / 100-500 ?g protein in 1 ml of a cell lysate.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC,IP,IHC,ICC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
Clone number:
145-2C11
Antibody Isotype:
IgG k
Application Details:
Flow cytometry: Recommended dilution: 1-2 ?g / ml (million cells). Immunoprecipitation: Recommended dilution: 1-2 ?g / 100-500 ?g protein in 1 ml of a cell lysate.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC,IP,IHC,ICC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
CD3 complex is crucial in transducing antigen-recognition signals into the cytoplasm of T cells and in regulating the cell surface expression of the TCR complex. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine-based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR-induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkynje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse BM10-37 cytotoxic T lymphocytes
Applications:
FC
Additional Info:
The Armenian hamster monoclonal antibody 145-2C11 reacts with an extracellular epitope of murine CD3 (epsilon subunit). This antibody is commonly used as a phenotypic marker for murine T cells.
CD26, also known as dipeptidyl peptidase IV (DPP-IV), is a homodimeric cell surface serine peptidase that degradates IFN-gamma-induced cytokines, acts as a T cell costimulatory molecule, and participates in multiple immunopathological roles in leukocyte homing and inflammation. Alterations in its peptidase activity are characteristic of malignant transformation. The enzymatic activity increases dramatically with tumour grade and severity. CD26 is expressed in various blood cell types, but also e.g. in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
BALB/c thymocytes
Applications:
IP,FC,IHC
Additional Info:
The rat monoclonal antibody H194-112 recognizes an extracellular epitope of CD26, a 110 kDa type II membrane glycoprotein, which is a peptidase expressed on mature thymocytes, T cells (especially activated), B cells, NK cells and macrophages.
CD26, also known as dipeptidyl peptidase IV (DPP-IV), is a homodimeric cell surface serine peptidase that degradates IFN-gamma-induced cytokines, acts as a T cell costimulatory molecule, and participates in multiple immunopathological roles in leukocyte homing and inflammation. Alterations in its peptidase activity are characteristic of malignant transformation. The enzymatic activity increases dramatically with tumour grade and severity. CD26 is expressed in various blood cell types, but also e.g. in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
BALB/c thymocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody H194-112 recognizes an extracellular epitope of CD26, a 110 kDa type II membrane glycoprotein, which is a peptidase expressed on mature thymocytes, T cells (especially activated), B cells, NK cells and macrophages.
CD2 belongs to T lymphocyte glycoproteins of immunoglobulin superfamily. Its interaction with CD58 stabilizes adhesion between T cells and antigen presenting or target cells. Relatively low affinity of CD2 to CD58 (as measured in solution) is compensated within the two-dimensional cell-cell interface to provide tight adhesion. Moreover, T cell activation induces increased CD2 expression and its lateral mobility, making easier contact between CD2 and CD58. Subsequently, T cell activation causes fixation of CD58-CD2 at sites of cell-cell contact, thereby strengthening intercellular adhesion. CD2 deficiency reduces intestinal inflammation and helps to control infection.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
murine thymocytes
Applications:
FA,FC,IP
Additional Info:
The rat monoclonal antibody RM2-5 recognizes an extracellular epitope of CD2, a 50 kDa glycoprotein present on the human peripheral blood T lymphocytes and NK cells; also expressed by all thymocytes.
CD2 belongs to T lymphocyte glycoproteins of immunoglobulin superfamily. Its interaction with CD58 stabilizes adhesion between T cells and antigen presenting or target cells. Relatively low affinity of CD2 to CD58 (as measured in solution) is compensated within the two-dimensional cell-cell interface to provide tight adhesion. Moreover, T cell activation induces increased CD2 expression and its lateral mobility, making easier contact between CD2 and CD58. Subsequently, T cell activation causes fixation of CD58-CD2 at sites of cell-cell contact, thereby strengthening intercellular adhesion. CD2 deficiency reduces intestinal inflammation and helps to control infection.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
murine thymocytes
Applications:
FC,IP
Additional Info:
The rat monoclonal antibody RM2-5 recognizes an extracellular epitope of CD2, a 50 kDa glycoprotein present on the human peripheral blood T lymphocytes and NK cells; also expressed by all thymocytes.
CD2 belongs to T lymphocyte glycoproteins of immunoglobulin superfamily. Its interaction with CD58 stabilizes adhesion between T cells and antigen presenting or target cells. Relatively low affinity of CD2 to CD58 (as measured in solution) is compensated within the two-dimensional cell-cell interface to provide tight adhesion. Moreover, T cell activation induces increased CD2 expression and its lateral mobility, making easier contact between CD2 and CD58. Subsequently, T cell activation causes fixation of CD58-CD2 at sites of cell-cell contact, thereby strengthening intercellular adhesion. CD2 deficiency reduces intestinal inflammation and helps to control infection.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
murine thymocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody RM2-5 recognizes an extracellular epitope of CD2, a 50 kDa glycoprotein present on the human peripheral blood T lymphocytes and NK cells; also expressed by all thymocytes.
CD2 belongs to T lymphocyte glycoproteins of immunoglobulin superfamily. Its interaction with CD58 stabilizes adhesion between T cells and antigen presenting or target cells. Relatively low affinity of CD2 to CD58 (as measured in solution) is compensated within the two-dimensional cell-cell interface to provide tight adhesion. Moreover, T cell activation induces increased CD2 expression and its lateral mobility, making easier contact between CD2 and CD58. Subsequently, T cell activation causes fixation of CD58-CD2 at sites of cell-cell contact, thereby strengthening intercellular adhesion. CD2 deficiency reduces intestinal inflammation and helps to control infection.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
murine thymocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody RM2-5 recognizes an extracellular epitope of CD2, a 50 kDa glycoprotein present on the human peripheral blood T lymphocytes and NK cells; also expressed by all thymocytes.
CD197 / CCR7 (chemokine receptor 7) is a seven membrane-spanning protein serving as a receptor for chemokines CCL19 and CCL21. It is expressed on most naive T cells, some hematopoietic stem cells, mature dendritic cells, NK cells and some memory T cells and B cells subsets. CD197 plays important roles in development of thymocytes, and regulating the recirculation and homing of lymphocytes and dendritic cells to secondary lymphoid organs.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine CD197-transfected RBL-2H3 cells
Applications:
FC,IP
Additional Info:
The rat monoclonal antibody 4B12 recognizes an extracellular epitope of murine CD197 / CCR7 (chemokine receptor 7), a 43 kDa G-protein-coupled receptor for chemokines CCL19 and CCL21.
CD197 / CCR7 (chemokine receptor 7) is a seven membrane-spanning protein serving as a receptor for chemokines CCL19 and CCL21. It is expressed on most naive T cells, some hematopoietic stem cells, mature dendritic cells, NK cells and some memory T cells and B cells subsets. CD197 plays important roles in development of thymocytes, and regulating the recirculation and homing of lymphocytes and dendritic cells to secondary lymphoid organs.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine CD197-transfected RBL-2H3 cells
Applications:
FC
Additional Info:
The rat monoclonal antibody 4B12 recognizes an extracellular epitope of murine CD197 / CCR7 (chemokine receptor 7), a 43 kDa G-protein-coupled receptor for chemokines CCL19 and CCL21.
CD19 is a transmembrane glycoprotein of Ig superfamily expressed by B cells from the time of heavy chain rearrangement until plasma cell differentiation. It forms a tetrameric complex with CD21 (complement receptor type 2), CD81 (TAPA-1) and Leu13. Together with BCR (B cell antigen receptor), this complex signals to decrease B cell treshold for activation by the antigen. Besides being signal-amplifying coreceptor for BCR, CD19 can also signal independently of BCR coligation and it turns out to be a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse CD19-transfected cell line
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody 1D3 detects an extracellular epitope of murine CD19, 95 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed on B lymphocytes and follicular dendritic cells; it is lost on plasma cells.
Clone number:
1D3
Antibody Isotype:
IgG2a
Application Details:
Functional application: This antibody can induce down-regulation of CD19, affecting the proportions of B cell subpopulations. Flow cytometry: Recommended dilution: 1-4 µg/ml
CD19 is a transmembrane glycoprotein of Ig superfamily expressed by B cells from the time of heavy chain rearrangement until plasma cell differentiation. It forms a tetrameric complex with CD21 (complement receptor type 2), CD81 (TAPA-1) and Leu13. Together with BCR (B cell antigen receptor), this complex signals to decrease B cell treshold for activation by the antigen. Besides being signal-amplifying coreceptor for BCR, CD19 can also signal independently of BCR coligation and it turns out to be a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Mouse CD19-transfected cell line
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody 1D3 detects an extracellular epitope of murine CD19, 95 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed on B lymphocytes and follicular dendritic cells; it is lost on plasma cells.
CD19 is a transmembrane glycoprotein of Ig superfamily expressed by B cells from the time of heavy chain rearrangement until plasma cell differentiation. It forms a tetrameric complex with CD21 (complement receptor type 2), CD81 (TAPA-1) and Leu13. Together with BCR (B cell antigen receptor), this complex signals to decrease B cell treshold for activation by the antigen. Besides being signal-amplifying coreceptor for BCR, CD19 can also signal independently of BCR coligation and it turns out to be a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Mouse CD19-transfected cell line
Applications:
FC
Additional Info:
The rat monoclonal antibody 1D3 detects an extracellular epitope of murine CD19, 95 kDa type I transmembrane glycoprotein (immunoglobulin superfamily) expressed on B lymphocytes and follicular dendritic cells; it is lost on plasma cells.
CD18, integrin beta2 subunit, forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits. These integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1; severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine cytotoxic T cell glycoproteins
Applications:
FC,IP,WB,IHC,FA
Additional Info:
The rat monoclonal antibody M18/2 recognizes an extracellular epitope of CD18 antigen (integrin beta2 subunit; beta2 integrin), a 95 kDa type I transmembrane protein expressed on all leukocytes.
CD18, integrin beta2 subunit, forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits. These integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1; severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine cytotoxic T cell glycoproteins
Applications:
FC,IP,WB,IHC
Additional Info:
The rat monoclonal antibody M18/2 recognizes an extracellular epitope of CD18 antigen (integrin beta2 subunit; beta2 integrin), a 95 kDa type I transmembrane protein expressed on all leukocytes.
CD18, integrin beta2 subunit, forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits. These integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1; severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine cytotoxic T cell glycoproteins
Applications:
FC
Additional Info:
The rat monoclonal antibody M18/2 recognizes an extracellular epitope of CD18 antigen (integrin beta2 subunit; beta2 integrin), a 95 kDa type I transmembrane protein expressed on all leukocytes.
CD16 (FcgammaRIII) is a 50-65 kDa glycoprotein serving as a low affinity IgG receptor. Unlike human, the murine protein is expressed only as a transmembrane isoform. Also CD32 (FcgammaRII) is a low affinity receptor for IgG, but its affinity is lower than that of CD16. These receptors are expressed on monocytes/macrophages, NK cells, granulocytes, mast cells, dendritic cells, and B cells. Their role is to mediate adaptive immune responses through binding the antibody-antigen immunocomplexes, but their effect on the particular cell differs according to the cell type.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine pre-B cells
Applications:
FC,IP
Additional Info:
The rat monoclonal antibody 93 recognizes a common extracellular epitope of murine CD16 (FcgammaRIII) and CD32 (FcgammaRII), the low affinity receptors for IgG.
CD16 (FcgammaRIII) is a 50-65 kDa glycoprotein serving as a low affinity IgG receptor. Unlike human, the murine protein is expressed only as a transmembrane isoform. Also CD32 (FcgammaRII) is a low affinity receptor for IgG, but its affinity is lower than that of CD16. These receptors are expressed on monocytes/macrophages, NK cells, granulocytes, mast cells, dendritic cells, and B cells. Their role is to mediate adaptive immune responses through binding the antibody-antigen immunocomplexes, but their effect on the particular cell differs according to the cell type.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine pre-B cells
Applications:
FC
Additional Info:
The rat monoclonal antibody 93 recognizes a common extracellular epitope of murine CD16 (FcgammaRIII) and CD32 (FcgammaRII), the low affinity receptors for IgG.
CD16 (FcgammaRIII) is a 50-65 kDa glycoprotein serving as a low affinity IgG receptor. Unlike human, the murine protein is expressed only as a transmembrane isoform. Also CD32 (FcgammaRII) is a low affinity receptor for IgG, but its affinity is lower than that of CD16. These receptors are expressed on monocytes/macrophages, NK cells, granulocytes, mast cells, dendritic cells, and B cells. Their role is to mediate adaptive immune responses through binding the antibody-antigen immunocomplexes, but their effect on the particular cell differs according to the cell type.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine pre-B cells
Applications:
FC
Additional Info:
The rat monoclonal antibody 93 recognizes a common extracellular epitope of murine CD16 (FcgammaRIII) and CD32 (FcgammaRII), the low affinity receptors for IgG.
CD154 / CD40L (CD40 ligand) is a member of the tumor necrosis factor family, and is expressed primarily on activated CD4+ lymphocytes, but also on mast cells, basophils, eosinophils and human dendritic cells. Its counter-receptor CD40 is expressed on antigen presenting cells, including dendritic cells, macrophages, and B cells, and also on fibroblasts. Triggering of CD40 by CD40L causes maturation of dendritic cells and upregulation of antigen presentation in functions of the MHC and costimulatory molecules. CD40L also functions as a direct stimulating factor for T cells. CD40L plays also roles e.g. in antibody class switching and modulation of apoptosis in the germinal center.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Activated mouse Th1 clone D1.6
Applications:
FC,IP,IHC,ICC,FA
Additional Info:
The Armenian hamster monoclonal antibody MR-1 detects an extracellular epitope on murine CD154 / CD40L (CD40-ligand), a 39 kDa cell surface type II glycoprotein expressed predominantly on activated CD4+ lymphocytes.
CD154 / CD40L (CD40 ligand) is a member of the tumor necrosis factor family, and is expressed primarily on activated CD4+ lymphocytes, but also on mast cells, basophils, eosinophils and human dendritic cells. Its counter-receptor CD40 is expressed on antigen presenting cells, including dendritic cells, macrophages, and B cells, and also on fibroblasts. Triggering of CD40 by CD40L causes maturation of dendritic cells and upregulation of antigen presentation in functions of the MHC and costimulatory molecules. CD40L also functions as a direct stimulating factor for T cells. CD40L plays also roles e.g. in antibody class switching and modulation of apoptosis in the germinal center.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Activated mouse Th1 clone D1.6
Applications:
FC,IP,IHC,ICC
Additional Info:
The Armenian hamster monoclonal antibody MR-1 detects an extracellular epitope on murine CD154 / CD40L (CD40-ligand), a 39 kDa cell surface type II glycoprotein expressed predominantly on activated CD4+ lymphocytes.
CD154 / CD40L (CD40 ligand) is a member of the tumor necrosis factor family, and is expressed primarily on activated CD4+ lymphocytes, but also on mast cells, basophils, eosinophils and human dendritic cells. Its counter-receptor CD40 is expressed on antigen presenting cells, including dendritic cells, macrophages, and B cells, and also on fibroblasts. Triggering of CD40 by CD40L causes maturation of dendritic cells and upregulation of antigen presentation in functions of the MHC and costimulatory molecules. CD40L also functions as a direct stimulating factor for T cells. CD40L plays also roles e.g. in antibody class switching and modulation of apoptosis in the germinal center.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Activated mouse Th1 clone D1.6
Applications:
FC
Additional Info:
The Armenian hamster monoclonal antibody MR-1 detects an extracellular epitope on murine CD154 / CD40L (CD40-ligand), a 39 kDa cell surface type II glycoprotein expressed predominantly on activated CD4+ lymphocytes.
CD11b (integrin alphaM subunit) is a 165-170 kDa type I transmembrane glycoprotein that non-covalently associates with integrin beta2 subunit (CD18); expression of the CD11b chain on the cell surface requires the presence of the CD18 antigen. CD11b/CD18 integrin (Mac-1, CR3) is highly expressed on NK cells, neutrophils, monocytes and less on macrophages. CD11b/CD18 integrin is implicated in various adhesive interactions of monocytes, macrophages and granulocytes, facilitating their diapedesis, as well as it mediates the uptake of complement coated particles, serving as a receptor for the iC3b fragment of the third complement component.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
B10 mouse spleen cells enriched for T cells
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody M1/70 detects an extracellular epitope of CD11b (integrin alphaM subunit), a type I transmembrane protein mainly expressed on monocytes/macrophages, granulocytes and NK-cells, which associates with CD18 to form Mac-1 integrin that plays important role in cell-cell interactions.
Clone number:
M1/70
Antibody Isotype:
IgG2b
Application Details:
Functional application: In vitro blocking of CD11b. Flow cytometry: Recommended dilution: 1 ?g/ml.
CD11b (integrin alphaM subunit) is a 165-170 kDa type I transmembrane glycoprotein that non-covalently associates with integrin beta2 subunit (CD18); expression of the CD11b chain on the cell surface requires the presence of the CD18 antigen. CD11b/CD18 integrin (Mac-1, CR3) is highly expressed on NK cells, neutrophils, monocytes and less on macrophages. CD11b/CD18 integrin is implicated in various adhesive interactions of monocytes, macrophages and granulocytes, facilitating their diapedesis, as well as it mediates the uptake of complement coated particles, serving as a receptor for the iC3b fragment of the third complement component.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
B10 mouse spleen cells enriched for T cells
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody M1/70 detects an extracellular epitope of CD11b (integrin alphaM subunit), a type I transmembrane protein mainly expressed on monocytes/macrophages, granulocytes and NK-cells, which associates with CD18 to form Mac-1 integrin that plays important role in cell-cell interactions.
CD11b (integrin alphaM subunit) is a 165-170 kDa type I transmembrane glycoprotein that non-covalently associates with integrin beta2 subunit (CD18); expression of the CD11b chain on the cell surface requires the presence of the CD18 antigen. CD11b/CD18 integrin (Mac-1, CR3) is highly expressed on NK cells, neutrophils, monocytes and less on macrophages. CD11b/CD18 integrin is implicated in various adhesive interactions of monocytes, macrophages and granulocytes, facilitating their diapedesis, as well as it mediates the uptake of complement coated particles, serving as a receptor for the iC3b fragment of the third complement component.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
B10 mouse spleen cells enriched for T cells
Applications:
FC
Additional Info:
The rat monoclonal antibody M1/70 detects an extracellular epitope of CD11b (integrin alphaM subunit), a type I transmembrane protein mainly expressed on monocytes/macrophages, granulocytes and NK-cells, which associates with CD18 to form Mac-1 integrin that plays important role in cell-cell interactions.
CD11b (integrin alphaM subunit) is a 165-170 kDa type I transmembrane glycoprotein that non-covalently associates with integrin beta2 subunit (CD18); expression of the CD11b chain on the cell surface requires the presence of the CD18 antigen. CD11b/CD18 integrin (Mac-1, CR3) is highly expressed on NK cells, neutrophils, monocytes and less on macrophages. CD11b/CD18 integrin is implicated in various adhesive interactions of monocytes, macrophages and granulocytes, facilitating their diapedesis, as well as it mediates the uptake of complement coated particles, serving as a receptor for the iC3b fragment of the third complement component.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
B10 mouse spleen cells enriched for T cells
Applications:
FC
Additional Info:
The rat monoclonal antibody M1/70 detects an extracellular epitope of CD11b (integrin alphaM subunit), a type I transmembrane protein mainly expressed on monocytes/macrophages, granulocytes and NK-cells, which associates with CD18 to form Mac-1 integrin that plays important role in cell-cell interactions.
CD11b (integrin alphaM subunit) is a 165-170 kDa type I transmembrane glycoprotein that non-covalently associates with integrin beta2 subunit (CD18); expression of the CD11b chain on the cell surface requires the presence of the CD18 antigen. CD11b/CD18 integrin (Mac-1, CR3) is highly expressed on NK cells, neutrophils, monocytes and less on macrophages. CD11b/CD18 integrin is implicated in various adhesive interactions of monocytes, macrophages and granulocytes, facilitating their diapedesis, as well as it mediates the uptake of complement coated particles, serving as a receptor for the iC3b fragment of the third complement component.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
B10 mouse spleen cells enriched for T cells
Applications:
FC
Additional Info:
The rat monoclonal antibody M1/70 detects an extracellular epitope of CD11b (integrin alphaM subunit), a type I transmembrane protein mainly expressed on monocytes/macrophages, granulocytes and NK-cells, which associates with CD18 to form Mac-1 integrin that plays important role in cell-cell interactions.
CD11a (LFA-1 alpha) together with CD18 constitute leukocyte function-associated antigen 1 (LFA-1), the alphaLbeta2 integrin. CD11a is implicated in activation of LFA-1 complex. LFA-1 is expressed on the plasma membrane of leukocytes in a low-affinity conformation. Cell stimulation by chemokines or other signals leads to induction the high-affinity conformation, which supports tight binding of LFA-1 to its ligands, the intercellular adhesion molecules ICAM-1, -2, -3. LFA-1 is thus involved in interaction of various immune cells and in their tissue-specific settlement, but participates also in control of cell differentiation and proliferation and of T-cell effector functions. Blocking of LFA-1 function by specific antibodies or small molecules has become an important therapeutic approach in treatment of multiple inflammatory diseases. For example, humanized anti-LFA-1 antibody Efalizumab (Raptiva) is being used to interfere with T cell migration to sites of inflammation; binding of cholesterol-lowering drug simvastatin to CD11a allosteric site leads to immunomodulation and increase in lymphocytic cholinergic activity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C57BL/6 mouse splenic secondary cytotoxic T lymphocytes
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody M17/4 reacts with an extracellular epitope of CD11a (alpha-subunit of murine LFA-1), a 180 kDa type I transmembrane glycoprotein expressed on B and T lymphocytes, monocytes, macrophages, neutrophils, basophils and eosinophils.
CD11a (LFA-1 alpha) together with CD18 constitute leukocyte function-associated antigen 1 (LFA-1), the alphaLbeta2 integrin. CD11a is implicated in activation of LFA-1 complex. LFA-1 is expressed on the plasma membrane of leukocytes in a low-affinity conformation. Cell stimulation by chemokines or other signals leads to induction the high-affinity conformation, which supports tight binding of LFA-1 to its ligands, the intercellular adhesion molecules ICAM-1, -2, -3. LFA-1 is thus involved in interaction of various immune cells and in their tissue-specific settlement, but participates also in control of cell differentiation and proliferation and of T-cell effector functions. Blocking of LFA-1 function by specific antibodies or small molecules has become an important therapeutic approach in treatment of multiple inflammatory diseases. For example, humanized anti-LFA-1 antibody Efalizumab (Raptiva) is being used to interfere with T cell migration to sites of inflammation; binding of cholesterol-lowering drug simvastatin to CD11a allosteric site leads to immunomodulation and increase in lymphocytic cholinergic activity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
C57BL/6 mouse splenic secondary cytotoxic T lymphocytes
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody M17/4 reacts with an extracellular epitope of CD11a (alpha-subunit of murine LFA-1), a 180 kDa type I transmembrane glycoprotein expressed on B and T lymphocytes, monocytes, macrophages, neutrophils, basophils and eosinophils.
CD11a (LFA-1 alpha) together with CD18 constitute leukocyte function-associated antigen 1 (LFA-1), the alphaLbeta2 integrin. CD11a is implicated in activation of LFA-1 complex. LFA-1 is expressed on the plasma membrane of leukocytes in a low-affinity conformation. Cell stimulation by chemokines or other signals leads to induction the high-affinity conformation, which supports tight binding of LFA-1 to its ligands, the intercellular adhesion molecules ICAM-1, -2, -3. LFA-1 is thus involved in interaction of various immune cells and in their tissue-specific settlement, but participates also in control of cell differentiation and proliferation and of T-cell effector functions. Blocking of LFA-1 function by specific antibodies or small molecules has become an important therapeutic approach in treatment of multiple inflammatory diseases. For example, humanized anti-LFA-1 antibody Efalizumab (Raptiva) is being used to interfere with T cell migration to sites of inflammation; binding of cholesterol-lowering drug simvastatin to CD11a allosteric site leads to immunomodulation and increase in lymphocytic cholinergic activity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
C57BL/6 mouse splenic secondary cytotoxic T lymphocytes
Applications:
FC
Additional Info:
The rat monoclonal antibody M17/4 reacts with an extracellular epitope of CD11a (alpha-subunit of murine LFA-1), a 180 kDa type I transmembrane glycoprotein expressed on B and T lymphocytes, monocytes, macrophages, neutrophils, basophils and eosinophils.
CD106 / VCAM-1 (vascular cell adhesion molecule-1) is an Ig-like cell surface adhesion molecule binding VLA-4 integrin. VCAM-1 is a potent T cell costimulatory molecule taking part in their positive selection and survival, as well as in adhesion, transendothelial migration and activation of peripheral T cells. VCAM-1 is also involved in endothelial cell-cell contacts. Whereas VCAM-1 normally mediates leukocyte extravasion to sites of tissue inflammation, tumour cells can use overexpressed VCAM-1 to escape T cell immunity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine preadipose cell line PA6
Applications:
FC,IP,IHC,FA
Additional Info:
The rat monoclonal antibody 429 (also known as MVCAM.A) recognizes an extracellular epitope of murine CD106, a 100-110 kDa type I membrane protein of the immunoglobulin superfamily, a crucial mediator of leukocyte adhesion, and a costimulation molecule.
CD106 / VCAM-1 (vascular cell adhesion molecule-1) is an Ig-like cell surface adhesion molecule binding VLA-4 integrin. VCAM-1 is a potent T cell costimulatory molecule taking part in their positive selection and survival, as well as in adhesion, transendothelial migration and activation of peripheral T cells. VCAM-1 is also involved in endothelial cell-cell contacts. Whereas VCAM-1 normally mediates leukocyte extravasion to sites of tissue inflammation, tumour cells can use overexpressed VCAM-1 to escape T cell immunity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Murine preadipose cell line PA6
Applications:
FC,IP,IHC
Additional Info:
The rat monoclonal antibody 429 (also known as MVCAM.A) recognizes an extracellular epitope of murine CD106, a 100-110 kDa type I membrane protein of the immunoglobulin superfamily, a crucial mediator of leukocyte adhesion, and a costimulation molecule.
CD106 / VCAM-1 (vascular cell adhesion molecule-1) is an Ig-like cell surface adhesion molecule binding VLA-4 integrin. VCAM-1 is a potent T cell costimulatory molecule taking part in their positive selection and survival, as well as in adhesion, transendothelial migration and activation of peripheral T cells. VCAM-1 is also involved in endothelial cell-cell contacts. Whereas VCAM-1 normally mediates leukocyte extravasion to sites of tissue inflammation, tumour cells can use overexpressed VCAM-1 to escape T cell immunity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine preadipose cell line PA6
Applications:
FC
Additional Info:
The rat monoclonal antibody 429 (also known as MVCAM.A) recognizes an extracellular epitope of murine CD106, a 100-110 kDa type I membrane protein of the immunoglobulin superfamily, a crucial mediator of leukocyte adhesion, and a costimulation molecule.
CD106 / VCAM-1 (vascular cell adhesion molecule-1) is an Ig-like cell surface adhesion molecule binding VLA-4 integrin. VCAM-1 is a potent T cell costimulatory molecule taking part in their positive selection and survival, as well as in adhesion, transendothelial migration and activation of peripheral T cells. VCAM-1 is also involved in endothelial cell-cell contacts. Whereas VCAM-1 normally mediates leukocyte extravasion to sites of tissue inflammation, tumour cells can use overexpressed VCAM-1 to escape T cell immunity.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Murine preadipose cell line PA6
Applications:
FC
Additional Info:
The rat monoclonal antibody 429 (also known as MVCAM.A) recognizes an extracellular epitope of murine CD106, a 100-110 kDa type I membrane protein of the immunoglobulin superfamily, a crucial mediator of leukocyte adhesion, and a costimulation molecule.
CD105 (endoglin) is a homodimeric transmembrane glycoprotein serving in presence of TGFbetaR-2 as a receptor for TGFbeta-1 and TGFbeta-3. CD105 is highly expressed on endothelial cells and promotes angiogenesis during wound healing, infarcts and in a wide range of tumours and its gene expression is stimulated by hypoxia. CD105 prevents apoptosis in hypoxic endothelial cells and also antagonises the inhibitory effects of TGFbeta-1 on vascular endothelial cell growth and migration. Normal cellular levels of CD105 are required for formation of new blood vessels.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Inflamed mouse skin
Applications:
FC,IP,WB,IHC
Additional Info:
The rat monoclonal antibody MJ7/18 reacts with an extracellular epitope of CD105 (Endoglin), a 90 kDa type I homodimerizing membrane glycoprotein expressed on vascular endothelial cells (small and large vessels), activated monocytes and tissue macrophages, stromal cells of certain tissues including bone marrow, pre-B lymphocytes in fetal marrow and erythroid precursors in fetal and adult bone marrow.
CD105 (endoglin) is a homodimeric transmembrane glycoprotein serving in presence of TGFbetaR-2 as a receptor for TGFbeta-1 and TGFbeta-3. CD105 is highly expressed on endothelial cells and promotes angiogenesis during wound healing, infarcts and in a wide range of tumours and its gene expression is stimulated by hypoxia. CD105 prevents apoptosis in hypoxic endothelial cells and also antagonises the inhibitory effects of TGFbeta-1 on vascular endothelial cell growth and migration. Normal cellular levels of CD105 are required for formation of new blood vessels.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Inflamed mouse skin
Applications:
FC
Additional Info:
The rat monoclonal antibody MJ7/18 reacts with an extracellular epitope of CD105 (Endoglin), a 90 kDa type I homodimerizing membrane glycoprotein expressed on vascular endothelial cells (small and large vessels), activated monocytes and tissue macrophages, stromal cells of certain tissues including bone marrow, pre-B lymphocytes in fetal marrow and erythroid precursors in fetal and adult bone marrow.
SLP65 / BLNK (SH2 domain-containing leukocyte-specific phosphoprotein of 65 kDa; B cell linker protein), also known as BASH, is an adaptor protein that plays key role in B cell activation initiated by cross-linking the B cell receptor (BCR). Phosphorylated by Syk tyrosine kinase, SLP65 serves as a scaffold for Btk tyrosine kinase, Vav1 guanine nucleotide exchange factor, phospholipase C gamma2, as well as Grb2 and Nck adaptor proteins; thus represents a central linker protein that bridges the BCR-associated kinases with a multitude of signaling pathways.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
A fusion protein representing amino acids 171-356 of human BLNK.
Applications:
WB
Additional Info:
The polyclonal antibody reacts with mouse SLP65 / BLNK, a cytosolic adaptor protein identified as two phosphoproteins migrating at 68 and 70 kDa in SDS/PAGE (alternatively spliced forms of human SLP65).
The mPlum is a red fluorescent protein with excitation maximum 589 nm and emission maximum 650 nm. It has around 29 kDa, and it is being used as a fluorescent tag in expression systems.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
mPlum from Discosoma sp.
Applications:
WB,ICC,FC
Clone number:
PAb (919)
Application Details:
Flow cytometry: Recommended dilution: 1-4 ?g/ml, extracellular staining or intracellular staining - depending on expression.Western blotting: Recommended dilution: 1-2 ?g/ml.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC,IP,IHC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC,IP,ICC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
MICA and MICB glycoproteins are members of MHC class I family, closely linked to HLA-B. However, unlike HLA molecules, MICA and MICB are not associated with beta2 microglobulin and are conformationally stable in the absence of conventional MHC class I peptide ligands. Both proteins are stress-induced antigens expressed mainly in gastrointestinal epithelium, where they are recognized by V-delta1 subset of gamma/delta T cells, and also on diverse epithelial tumor cells. Binding of MICA/MICB receptor, the NKG2D, leads to cytolytic response of NK cells, Tc cells, and gamma/delta T cells. Alternative splicing results in multiple isoforms, and some of them have been associated with susceptibility to psoriasis and psoriatic arthritis. Shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Transfected C1R cells expressing MICA
Applications:
FC
Additional Info:
The mouse monoclonal antibody 6D4 recognizes a common extracellular epitope on MICA and MICB glycoproteins, transmembrane ligands of NKG2D, and is able to block NKG2D-mediated activation of NK cells and cytotoxic T cells.
The mCherry is a red fluorescent protein with excitation maximum 587 nm and emission maximum 610 nm. It has around 28 kDa, and it is being used as a fluorescent tag in expression systems.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
mCherry protein from Anaplasma marginale
Applications:
WB,ICC,FC
Clone number:
PAb (918)
Application Details:
Flow cytometry: Recommended dilution: 1-4 ?g/ml, extracellular staining or intracellular staining - depending on expression.Western blotting: Recommended dilution: 1-2 ?g/ml.
MAP2a and 2b (270 kDa) being found mostly in dendrites, stabilize microtubules (shift the reaction kinetics in addition of new subunits and microtubule growth) and participate in determining the structure of different parts of vertebrate nerve cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Microtubule protein (bovine brain) enriched for kinesin
Applications:
IP,WB,IHC,ICC,ELISA
Additional Info:
The antibody MT-07 recognizes an epitope (aa 1375-1395) located in central domain of molecule Microtubule Associated Protein 2ab (MAP2ab), an intracellular antigen.
MAP2a and 2b (270 kDa) being found mostly in dendrites, stabilize microtubules (shift the reaction kinetics in addition of new subunits and microtubule growth) and participate in determining the structure of different parts of vertebrate nerve cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Microtubule protein (bovine brain) enriched for kinesin
Applications:
IP,WB,IHC,ICC,ELISA
Additional Info:
The antibody MT-08 recognizes an epitope (aa 1375-1395) located in central domain of molecule Microtubule Associated Protein 2ab (MAP2ab), an intracellular antigen.
MAP2a and 2b (270 kDa) being found mostly in dendrites, stabilize microtubules (shift the reaction kinetics in addition of new subunits and microtubule growth) and participate in determining the structure of different parts of vertebrate nerve cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Termostabile fraction of bovine brain microtubules (whole MAP2ab molecule).
Applications:
IP,WB,ICC
Additional Info:
The antibody MT-01 reacts with Microtubule Associated Protein 2ab (MAP2ab), an intracellular antigen.
Lysozyme is anti-bacterial enzyme found mainly in milk, saliva, tears, plasma, spleen, mucus, and leukocytes (e.g. in cytoplasmic granules of neutrophils). It damages bacterial cell walls by hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Lysozyme is part of the innate immune system. It protects wet body surfaces, such as conjunctiva. Reduced lysozyme levels have been associated with bronchopulmonary dysplasia in newborns. On the other hand high lysozyme blood levels produced for example by myelomonocytic leukemia cells can lead to kidney failure and low blood potassium.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
human lysozyme
Applications:
FC,ICC
Additional Info:
The mouse monoclonal antibody LZ598-10G9 recognizes lysozyme, an approximately 17 kDa antibacterial enzyme, which is being used as a marker for the lineage diagnosis of acute leukemias (intracellular antigen).
Lysozyme is anti-bacterial enzyme found mainly in milk, saliva, tears, plasma, spleen, mucus, and leukocytes (e.g. in cytoplasmic granules of neutrophils). It damages bacterial cell walls by hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Lysozyme is part of the innate immune system. It protects wet body surfaces, such as conjunctiva. Reduced lysozyme levels have been associated with bronchopulmonary dysplasia in newborns. On the other hand high lysozyme blood levels produced for example by myelomonocytic leukemia cells can lead to kidney failure and low blood potassium.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
human lysozyme
Applications:
FC
Additional Info:
The mouse monoclonal antibody LZ598-10G9 recognizes lysozyme, an approximately 17 kDa antibacterial enzyme, which is being used as a marker for the lineage diagnosis of acute leukemias (intracellular antigen).
Lysozyme is anti-bacterial enzyme found mainly in milk, saliva, tears, plasma, spleen, mucus, and leukocytes (e.g. in cytoplasmic granules of neutrophils). It damages bacterial cell walls by hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Lysozyme is part of the innate immune system. It protects wet body surfaces, such as conjunctiva. Reduced lysozyme levels have been associated with bronchopulmonary dysplasia in newborns. On the other hand high lysozyme blood levels produced for example by myelomonocytic leukemia cells can lead to kidney failure and low blood potassium.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
human lysozyme
Applications:
FC
Additional Info:
The mouse monoclonal antibody LZ598-10G9 recognizes lysozyme, an approximately 17 kDa antibacterial enzyme, which is being used as a marker for the lineage diagnosis of acute leukemias (intracellular antigen).
Lyn is a Src-family protein tyrosine kinase that is predominantly expressed in hematopoietic cells. It is associated with a number of cell surface receptors including the B cell antigen receptor (BCR) and Fc receptors. Upon their triggering, Lyn phosphorylates subunits of these receptors in a cholesterol-dependent manner, utilizing the plasma membrane lipid raft system. The phosphorylated intracellular domains of the receptors are accessible for cytoplasmic Syk tyrosine kinase, which is activated by Lyn-mediated phosphorylation and which transduces the signal to downstream adaptors. Lyn is abnormally distributed in acute myeloid leukemia cells and seems to be a novel pharmacologic target of this disease.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed recombinant fragment of human Lyn (aa 8 - 238).
Applications:
IP,WB,ICC
Additional Info:
The antibody LYN-01 reacts with Lyn (p56/p53), a non-receptor Src-family tyrosine kinase expressed in hematopoietic tissues (intracellular antigen).
Clone number:
LYN-01
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1-2 ?g/ml.
LST1 (leukocyte-specific transcript 1, also known as B144) is expressed in cells of myeloid/erythroid lineage (monocytes, granulocytes, dendritic cells, platelets, erythrocytes). At least 14 alternatively spliced variants (LST1/A – LST1/N) can be detected; some of them (LST1/A, B, C, G, I, K) are transmembrane cell surface-exposed forms, the other are soluble. LST1 induces production of long, thin filopodia in dendritic cells, has an inhibitory effect on lymphocyte proliferation and may have an immunomodulatory role. LST1/A is an 11 kDa transmembrane adaptor present in membrane rafts and forms spontaneously covalent homodimers. Its intracellular domain contains two tyrosine motifs, one of them being an ITIM very similar to such motifs in Siglec.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
KLH-fused peptide corresponding to amino acids SSEGPDLRGRDKRGT of human LST1
Applications:
IP,WB,ICC
Additional Info:
The antibody LST1/02 reacts with an extracellular epitope of LST1, an approximately 6-11 kDa protein expressed as various transmembrane or soluble forms. LST1 is found predominantly on monocytes and dendritic cells. It migrates on SDS PAGE gels as approximately 25-28 kDa molecule.
Clone number:
LST1/02
Antibody Isotype:
IgG1
Application Details:
Immunoprecipitation: Positive control: RAJI human Burkitt lymphoma cell line. Western blotting: The antigen migrates on SDS PAGE gels as approximately 25-28 kDa molecule.
GARP (glycoprotein A repetitions predominant protein), also known as garpin or LRRC32 (leucin-rich repeat containing protein 32) is an approximately 80 kDa transmembrane glycoprotein detected on the surface of megakaryocytes, platelets, and activated Treg cells. It binds to the latency-associated peptide (LAP) domain of pro-TGF beta and regulates its storage and activation. The expression of GARP on Treg cells seems to be necessary for their suppressive functions.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified human sGARP protein
Applications:
WB
Additional Info:
The mouse monoclonal antibody GARP5 recognizes GARP / LRRC32, an approximately 80 kDa glycoprotein expressed e.g. on the surface of megakaryocytes, platelets and activated Treg cells.
Clone number:
GARP5
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1-2 ?g/ml; positive control: human thrombocytes, reducing conditions
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed intracellular fragment corresponding to aa 141-295 of human LIME.
Applications:
IP,FC
Additional Info:
The antibody LIME-06 was raised against intracellular fragment corresponding to aa 141-295 of human LIME, a 30 kDa Lck-interacting transmembrane adaptor expressed by T cells.
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially expressed intracellular fragment corresponding to aa 141-295 of human LIME.
Applications:
WB,IHC
Additional Info:
The polyclonal antibody reacts with the cytoplasmic domain of LIME, a 30 kDa Lck-interacting transmembrane adaptor expressed by T cells.
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
COOH-terminal peptide comprising residues 281-296 of the human LIME conjugated to keyhole limpet hemocyanin.
Applications:
WB,IHC
Additional Info:
The antibody LIME-10 reacts with the cytoplasmic domain of LIME, a 30 kDa Lck-interacting transmembrane adaptor expressed by T cells.
LIME (Lck-interacting molecule) is a 30 kDa double-palmitoylated protein with unusually basic cytoplasmic domain, expressed by T cells. After ligation of CD4 or CD8 T cell coreceptors, LIME is phosphorylated by Src-family kinases and associates with Lck and Fyn kinases and with their negative regulator Csk. Interestingly, Csk-mediated phosphorylation of C-terminal negative-regulatory tyrosine of LIME-associated Lck can result in increase of enzymatic activity compared with the total pool of Lck, thus, LIME serves as a positive regulator of TCR-dependent T cell signaling. However, under some circumstances, LIME may mediate inhibitory signals.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Bacterially expressed intracellular fragment corresponding to aa 141-295 of human LIME.
Applications:
FC
Additional Info:
The antibody LIME-06 was raised against intracellular fragment corresponding to aa 141-295 of human LIME, a 30 kDa Lck-interacting transmembrane adaptor expressed by T cells.
Lck is a Src-family tyrosine kinase, which is essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, Lck phosphorylates the ITAM motives in its zeta subunits, establishing binding sites for the SH2 domains of the tyrosine kinase ZAP70, which is also phosphorylated by Lck and thereby activated to generate subsequent signaling platforms by phosphorylation of adaptor LAT. Whereas the majority of Lck is localized to the plasma membrane, there is also a significant fraction associated with the Golgi apparatus, which may contribute to Raf activation under conditions of weak stimulation through the TCR. Lck is also involved in the regulation of apoptosis induced by various stimuli, but not by the death receptors.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Peptide corresponding to amino acids 22-36 in the sequence of human Lck.
Applications:
FC,IP,WB,ICC
Additional Info:
The antibody LCK-01 recognizes defined epitope (aa 22-36) of Lck, a 56 kDa Src-family protein tyrosine kinase (intracellular antigen).
LAT (linker for activation of T cells) is a 36-38 kDa double-palmitoylated transmembrane adaptor protein expressed by T cells, pre-B cells, NK cells, mast cells and platelets. After immunoreceptor triggering, LAT becomes multiply tyrosine-phosphorylated by Syk-, Src-, or Tec-family kinases, providing docking sites for downstream signaling molecules. LAT is essential for TCR-dependent T cell- and FcepsilonRI-dependent mast cell activation, as well as for maturation of early thymocytes. It is also involved in NK cell signaling and platelet activation.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Bacterially produced recombinant polypeptide
corresponding to the entire cytoplasmic domain of human LAT.
Applications:
WB,IP,FC
Additional Info:
The antibody LAT-01 reacts with an intracellular epitope of LAT, a 36-38 kDa transmembrane adaptor protein expressed by T cells, pre-B cells, NK cells, mast cells and platelets.
Clone number:
LAT-01
Antibody Isotype:
IgG1
Application Details:
Immunoprecipitation: Tyrosine-phosphorylated form of LAT is not optimally recognized. Flow cytometry: Intracellular staining. Tyrosine-phosphorylated form of LAT is not optimally recognized.Western blotting: Recommended dilution: 1-2 ?g/ml.
LARGE1 serves as a glycosyltransferase which participates in glycosylation of the muscle membrane protein alpha-dystroglycan. Mutations of LARGE1 lead to hypoglycosylation of alpha-dystroglycan and cause congenital muscular dystrophy (MDC1D) associated with severe mental retardation. Altered alpha-dystroglycan glycosylation may also play a role in cancer, as hypoglycosylation of the protein and loss of laminin binding have been demonstrated in invasive carcinoma cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant fragment of human LARGE1 (amino acids 35-142)
Applications:
FC,WB
Additional Info:
The mouse monoclonal antibody LARGE-02 recognizes human LARGE1, a glycosyltransferase expressed mainly in the Golgi apparatus. Crossreactivity with LARGE2 was not determined.
LARGE1 serves as a glycosyltransferase which participates in glycosylation of the muscle membrane protein alpha-dystroglycan. Mutations of LARGE1 lead to hypoglycosylation of alpha-dystroglycan and cause congenital muscular dystrophy (MDC1D) associated with severe mental retardation. Altered alpha-dystroglycan glycosylation may also play a role in cancer, as hypoglycosylation of the protein and loss of laminin binding have been demonstrated in invasive carcinoma cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant fragment of human LARGE1 (amino acids 35-142)
Applications:
FC
Additional Info:
The mouse monoclonal antibody LARGE-02 recognizes human LARGE1, a glycosyltransferase expressed mainly in the Golgi apparatus. Crossreactivity with LARGE2 was not determined.
Lactoferrin is an iron-binding glycoprotein of the transferrin family, which is released to most biological fluids, with particularly high levels in milk. It has anti-inflammatory (e.g. sequestering of lipopolysaccharides), anti-microbial (e.g. blocking of viral attachment to the target cell), and immunomodulatory properties and can prevent infections in young children. Lactoferrin is considered to bridge the innate and adaptive immune responses. It also participates in iron homeostasis, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Besides biological fluids it is also found in the secondary granules of neutrophils.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
human lactoferrin
Applications:
FC,ELISA
Additional Info:
The mouse monoclonal antibody LF5-1D2 recognizes lactoferrin, an iron-binding secreted glycoprotein of about 90 kDa, which has anti-inflammatory, immunomodulatory and anti-microbial properties.
Lactoferrin is an iron-binding glycoprotein of the transferrin family, which is released to most biological fluids, with particularly high levels in milk. It has anti-inflammatory (e.g. sequestering of lipopolysaccharides), anti-microbial (e.g. blocking of viral attachment to the target cell), and immunomodulatory properties and can prevent infections in young children. Lactoferrin is considered to bridge the innate and adaptive immune responses. It also participates in iron homeostasis, regulation of cellular growth and differentiation and protection against cancer development and metastasis. Besides biological fluids it is also found in the secondary granules of neutrophils.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
human lactoferrin
Applications:
FC
Additional Info:
The mouse monoclonal antibody LF5-1D2 recognizes lactoferrin, an iron-binding secreted glycoprotein of about 90 kDa, which has anti-inflammatory, immunomodulatory and anti-microbial properties.
Clone number:
LF5-1D2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
Ku Antigen (DNA-dependent DNA helicase) is a heterodimer (of 72 and 87 kDa polypeptides) which contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the nonhomologous end-joining pathway. A DNA double-strand break is a major lesion that destroys the integrity of the DNA molecule. Such damage is introduced by ionizing radiation. Ku binds to free double-stranded DNA ends and is the DNA-binding component of the DNA-dependent protein kinase. Thus, the Ku protein is involved in DNA repair and in V(D)J recombination, and the Ku-DNA-dependent protein kinase complex may have a role in those same processes. Ku70 and Ku80 share a common topology and form a dyad-symmetrical molecule with a preformed ring that encircles duplex DNA. The binding site can cradle 2 full turns of DNA while encircling only the central 3-4 base pairs. Ku makes no contacts with DNA bases and few with the sugar-phosphate backbone, but it fits sterically to major and minor groove contours so as to position the DNA helix in a defined path through the protein ring. These features are well designed to structurally support broken DNA ends and to bring the DNA helix into phase across the junction during end processing and ligation. Mouse cells deficient for Ku80 display a marked increase in chromosomal aberrations, including breakage, translocations, and aneuploidy. Despite the observed chromosome instabilities, Ku80 -/- mice have only a slightly earlier onset of cancer. Loss of p53 synergizes with Ku80 to promote tumorigenesis such that all Ku80 -/- and p53 -/- mice succumb to disseminated pro-B-cell lymphoma before 3 months of age. The p70/p80 complex binds to the ends of double-stranded DNA in a cell cycle-dependent manner, being associated with chromosomes of interphase cells, followed by complete dissociation from the condensing chromosomes in early prophase. Some patients with systemic lupus erythematosus produce very large amounts of autoantibodies to p70 and p80. The autoantibody has been found in patients with autoimmune thyroid disease (Graves disease) as well as in those with lupus.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
human whole T-lymphocytes
Applications:
ICC,IP
Additional Info:
The antibody MEM-54 reacts with Ku80, a 80 kDa subunit of Ku autoantigen (heterodimer of 72 and 87 kDa intracellular polypeptides). Ku autoantigen is involved in DNA repair and in V(D)J recombination through its ability to bind DNA double-strand breaks.
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Product Type:
Antibodies Primary
Antibody Type:
polyclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
stalk domain of human kinesin (aa 331-906) expressed in E. coli (FKHC3)
Applications:
WB,ICC
Additional Info:
The polyclonal antibody detects total level of endogenous kinesin protein (intracellular antigen).
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Enriched fraction of porcine brain kinesin.
Applications:
ICC
Additional Info:
The antibody KN-03 recognizes heavy chain of conventional kinesin, a protein associated with intracellular vesicles, and with lower affinity with denaturated molecule. It stains Western blots of kinesin-enriched preparations. Epitope mapping (by limited proteolysis of partially purified porcine kinesin) followed by immunoblotting has revealed that antibodies KN-01, KN-02 and KN-03 react with different sets of fragments The antibody KN-03 well recognizes kinesin bound to taxol-stabilized microtubules.
Kinesin belongs to the group of microtubule-associated motor proteins known to convert chemical energy released from nucleoside triphosphates (preferentially from ATP) into mechanical energy. Conventional kinesin, member of the kinesin superfamily comprising more than 100 proteins, is involved in the anterograde vesicle transport in neuronal cells. Kinesin purified from mammalian brain homogenates is a heterotetramer consisting of two heavy (120 to 130 kDa) and two light chains (60 to 70 kDa), resulting in a molecular mass about 400 kDa. Each heavy chain contains an N-terminal globular motordomain with both a microtubule-binding site and an ATPase active center, stalk region responsible for heavy chain dimerization and finally C-terminal globular tail domain, which is implicated in cargo binding. Light chains may have a regulatory function.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Enriched fraction of porcine brain kinesin.
Applications:
ICC
Additional Info:
The antibody KN-02 recognizes heavy chain of conventional kinesin, a protein associated with intracellular vesicles, and with lower affinity with denaturated molecule. Epitope is located in coiled-coil stalk domain. It stains Western blots of kinesin-enriched preparations. Epitope mapping (by limited proteolysis of partially purified porcine kinesin) followed by immunoblotting has revealed that antibodies KN-01, KN-02 and KN-03 react with different sets of fragments. The antibody KN-02 does not react with kinesin bound to taxol-stabilized microtubules.
Ki-67 is a highly protease-sensitive nuclear protein expressed in two isoforms (345 kDa and 395 kDa), both of which are identified by the antibody clone Ki-67. The Ki-67 antigen is essential for cell proliferation and its expression is restricted to the cycling cells. It is detected in G1, S, G2 and M phase, whereas it is absent in cells which are in G0 phase and it is not associated with DNA repair processes. Ki-67 thus represents an important tool for detection of proliferating cells, which is of great importance in tumor diagnostics and is commonly used as a prognostic factor in cancer studies.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Nuclei of the Hodgkin lymphoma cell line L428
Applications:
FC,WB,IHC,ICC
Additional Info:
The mouse monoclonal antibody Ki-67 recognizes Ki-67 antigen, a non-histone nuclear protein expressed exclusively in proliferating cells.
Ki-67 is a highly protease-sensitive nuclear protein expressed in two isoforms (345 kDa and 395 kDa), both of which are identified by the antibody clone Ki-67. The Ki-67 antigen is essential for cell proliferation and its expression is restricted to the cycling cells. It is detected in G1, S, G2 and M phase, whereas it is absent in cells which are in G0 phase and it is not associated with DNA repair processes. Ki-67 thus represents an important tool for detection of proliferating cells, which is of great importance in tumor diagnostics and is commonly used as a prognostic factor in cancer studies.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Nuclei of the Hodgkin lymphoma cell line L428
Applications:
FC
Additional Info:
The mouse monoclonal antibody Ki-67 recognizes Ki-67 antigen, a non-histone nuclear protein expressed exclusively in proliferating cells.
Clone number:
Ki-67
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests. Intracellular staining.
Ki-67 is a highly protease-sensitive nuclear protein expressed in two isoforms (345 kDa and 395 kDa), both of which are identified by the antibody clone Ki-67. The Ki-67 antigen is essential for cell proliferation and its expression is restricted to the cycling cells. It is detected in G1, S, G2 and M phase, whereas it is absent in cells which are in G0 phase and it is not associated with DNA repair processes. Ki-67 thus represents an important tool for detection of proliferating cells, which is of great importance in tumor diagnostics and is commonly used as a prognostic factor in cancer studies.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Nuclei of the Hodgkin lymphoma cell line L428
Applications:
FC
Additional Info:
The mouse monoclonal antibody Ki-67 recognizes Ki-67 antigen, a non-histone nuclear protein expressed exclusively in proliferating cells.
Clone number:
Ki-67
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
Insulin and glucagon are pancreatic endocrine hormones secreted by islet cells within the pancreas. The stimulus for insulin secretion is a HIGH blood glucose. Deficiency of insulin results in diabetes mellitus, one of the leading causes of morbidity and mortality in the general population.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Porcine insulin.
Applications:
ELISA,RIA,IHC,ICC,FA
Additional Info:
The antibody IN-05 reacts with insulin, one of the major regulatory endocrine hormones of intermediate metabolism, normally secreted by the beta cells (a type of islet cells) of the pancreas; it is also present in tumors of B cell origin such as insulinoma.
Clone number:
IN-05
Antibody Isotype:
IgG1
Application Details:
Functional application: The antibody IN-05 blocks binding of insulin to the receptor.
Insulin and glucagon are pancreatic endocrine hormones secreted by islet cells within the pancreas. The stimulus for insulin secretion is a HIGH blood glucose. Deficiency of insulin results in diabetes mellitus, one of the leading causes of morbidity and mortality in the general population.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Porcine insulin.
Applications:
ELISA,RIA,IHC,ICC
Additional Info:
The antibody IN-05 reacts with insulin, one of the major regulatory endocrine hormones of intermediate metabolism, normally secreted by the beta cells (a type of islet cells) of the pancreas; it is also present in tumors of B cell origin such as insulinoma.
Ikaros, also known as IKZF1 (Ikaros family zinc finger protein 1) is a hematopoietic-specific transcription factor involved in the regulation of lymphocyte development, together with other members of this family, such as Aiolos and Helios. Ikaros forms homo- and heterodimers with these proteins and functions predominantly in early hematopoietic development. Expression of Ikaros, Aiolos and Helios is restricted to cells of the hematopoietic system, whereas other family members, Eos and Pegassus, are more widely expressed. Disruption of Ikaros leads to T and B cell leukemias.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human Ikaros (C-terminal part)
Applications:
FC,IP,WB,ICC
Additional Info:
The mouse monoclonal antibody 4E9 recognizes Ikaros, a transcription factor (intracellular antigen) expressed broadly in hematopoietic progenitors and serving as a key regulator of lymphopoiesis.
Ikaros, also known as IKZF1 (Ikaros family zinc finger protein 1) is a hematopoietic-specific transcription factor involved in the regulation of lymphocyte development, together with other members of this family, such as Aiolos and Helios. Ikaros forms homo- and heterodimers with these proteins and functions predominantly in early hematopoietic development. Expression of Ikaros, Aiolos and Helios is restricted to cells of the hematopoietic system, whereas other family members, Eos and Pegassus, are more widely expressed. Disruption of Ikaros leads to T and B cell leukemias.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Recombinant human Ikaros (C-terminal part)
Applications:
FC
Additional Info:
The mouse monoclonal antibody 4E9 recognizes Ikaros, a transcription factor (intracellular antigen) expressed broadly in hematopoietic progenitors and serving as a key regulator of lymphopoiesis.
Clone number:
4000000000
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human interferon gamma
Applications:
IP,ELISA,RIA
Additional Info:
The mouse monoclonal antibody NIB42 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
NIB42
Antibody Isotype:
IgG1 k
Application Details:
ELISA: Capture antibody in combination with detection antibody 4S.B3.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Interferon gamma derived from human leukocytes
Applications:
FC,IP,WB,IHC,ICC,ELISA,RIA
Additional Info:
The mouse monoclonal antibody 4S.B3 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
4S.B3
Antibody Isotype:
IgG1 k
Application Details:
ELISA: This antibody is being used as detection antibody in combination with capture antibody NIB42. Flow cytometry: Recommended dilution: 1-4 µg/ml. Intracellular staining.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Recombinant human IFN-gamma (aa 22-166 representing mature IFN-gamma)
Applications:
FC,WB,ELISA
Additional Info:
The mouse monoclonal antibody G-23 reacts with IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Interferon gamma derived from human leukocytes
Applications:
FC
Additional Info:
The mouse monoclonal antibody 4S.B3 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
4S.B3
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Interferon gamma derived from human leukocytes
Applications:
FC
Additional Info:
The mouse monoclonal antibody 4S.B3 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
4S.B3
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests. Intracellular staining.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Interferon gamma derived from human leukocytes
Applications:
FC,IP,WB,IHC,ICC,ELISA
Additional Info:
The mouse monoclonal antibody 4S.B3 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
The interferon gamma (IFN-gamma; 16-25 kDa) is an important regulator of the immune response, produced in activated Th1 cells and NK cells, particularly in response to IL-2, TNF-alpha and IL-12; its production is suppressed by IL-4, IL-10, and TGF-beta. The producing of IFN-gamma is activated by specific antigens or mitogens through the T cell antigen receptor. IFN-gamma polypeptide forms: 40-60 kDa forms are observable under non-denaturing conditions as dimers and trimers; 20 kDa and 25 kDa forms exist due to variable glycosylation. IFN-gamma belongs to the type II interferons, also called immune IFN. IFN-gamma shows antiviral activity and has important immunoregulatory functions. It is a potent activator of macrophages and had antiproliferative effects on transformed cells. IFN-gamma plays an important role in regulating B cell differentiation by simultaneously stimulating class switch recombination to the IgG3 and IgG2a isotypes while represing class switch recombination to the IgE and IgG1 isotypes. It also appears to promote antigen presentation by B cells through its effects on MHC. Binding of IFN-gamma to its receptor increases the expression of class I MHC on all somatic cells. It also enhances the expression of class II MHC on antigen-presenting cells. IFN-gamma is the major means by which T cells activate macrophages, increasing their ability to kill bacteria, parasites, and tumours. The activation of macrophages by IFN-gamma is essential for the elimination of bacteria that replicate within the phagosomes of macrophages (f.e. Mycobacteria and Listeria monocytogenes). IFN-gamma can potentiate the high antiviral and antitumor effects of the type I interferons (IFN-alpha, IFN-beta). IFN-gamma may also activate neutrophils and NK cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Interferon gamma derived from human leukocytes
Applications:
FC
Additional Info:
The mouse monoclonal antibody 4S.B3 recognizes IFN-gamma, a 16-25 kDa cytokine produced by activated Th1 cells and NK cells. Binds both glycosylated and non-glycosylated protein.
Clone number:
4S.B3
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
TROP2 is a cell surface receptor that transduces calcium signals. It belongs to carcinoma-associated antigens. Mutations of TROP2 have been associated with gelatinous drop-like corneal dystrophy.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
TROP2-transfected CHO cells
Applications:
WB,FC,IHC,ICC
Clone number:
TrMab-6
Antibody Isotype:
IgG2b k
Application Details:
Flow cytometry: Recommended dilution: 1-4 ?g/ml.Western blotting: Recommended dilution: 1 ?g/ml.Immunocytochemistry: Recommended dilution: 10 ?g/ml; the cells can be fixed with 4% PFA and permeabilized with 0.1% Triton X-100 before antibody staining, when needed. Immunohistochemistry (paraffin sections): Recommended dilution: 10 ?g/ml. Heat-mediated antigen retrieval in citrate buffer, pH = 6.
TROP2 is a cell surface receptor that transduces calcium signals. It belongs to carcinoma-associated antigens. Mutations of TROP2 have been associated with gelatinous drop-like corneal dystrophy.
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
TROP2 is a cell surface receptor that transduces calcium signals. It belongs to carcinoma-associated antigens. Mutations of TROP2 have been associated with gelatinous drop-like corneal dystrophy.
TROP2 is a cell surface receptor that transduces calcium signals. It belongs to carcinoma-associated antigens. Mutations of TROP2 have been associated with gelatinous drop-like corneal dystrophy.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
TROP2-transfected CHO cells
Applications:
FC
Clone number:
TrMab-6
Antibody Isotype:
IgG2b k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
Tomm34 (translocase of the outer mitochondrial membrane 34) is an additional component of the cellular chaperone system involved in protein folding. As the name suggests, Tomm34 was initially identified as being involved in mitochondrial protein processing. Subsequent studies have shown that Tomm34 interacts with both Hsp70 and Hsp90 and modifies their protein folding activities. In cancer, high levels of Tomm34 have been reported in bladder, colorectal and breast cancers compared to their normal tissue counterparts. In these cancers, Tomm34 promotes colorectal cancer cell growth and is a biomarker of poor outcome in early invasive breast cancer and bladder cancer. As a tumour-associated protein, Tomm34 peptide vaccination is under investigation as a therapeutic option for colorectal cancer, with significant Tomm34 cytotoxic T-lymphocyte (CTL) response observed.
TCR Vgamma9 is a variant of TCR gamma chain, that is present on a subset of human gamma/delta T cells. TCR Vgamma9/Vdelta2 T cells are able to recognize and kill various tumor cells, as this receptor heterodimer binds to certain phosphoantigens, expressed by tumors.
TCR Vgamma9 is a variant of TCR gamma chain, that is present on a subset of human gamma/delta T cells. TCR Vgamma9/Vdelta2 T cells are able to recognize and kill various tumor cells, as this receptor heterodimer binds to certain phosphoantigens, expressed by tumors.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
human T cells
Applications:
FC
Clone number:
B3
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
TCR Vgamma4 is a variant of TCR gamma chain, that is present on a minor subset of human gamma/delta T cells.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
human T cells
Applications:
FC
Clone number:
4A11.904
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
TCR Vdelta2 is a variant of TCR delta chain, that is present on a major subset of human gamma/delta T cells. TCR Vgamma9/Vdelta2 (or Vgamma2/Vdelta2) T cells are able to recognize and kill various tumor cells, as this receptor heterodimer binds to certain phosphoantigens, expressed by tumors. They can recognize these antigens in an MHC-unrestricted manner. Similarly to NK cells, Vdelta2 T cells express MHC I receptors and killer Ig-like receptors, that are involved in tumor recognition and cytolysis. The potently cytotoxic subset of them is identified by cell surface expression of polysialyated CD56.
TCR Vdelta2 is a variant of TCR delta chain, that is present on a major subset of human gamma/delta T cells. TCR Vgamma9/Vdelta2 (or Vgamma2/Vdelta2) T cells are able to recognize and kill various tumor cells, as this receptor heterodimer binds to certain phosphoantigens, expressed by tumors. They can recognize these antigens in an MHC-unrestricted manner. Similarly to NK cells, Vdelta2 T cells express MHC I receptors and killer Ig-like receptors, that are involved in tumor recognition and cytolysis. The potently cytotoxic subset of them is identified by cell surface expression of polysialyated CD56.
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The antibody MEM-262 recognizes beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human thymoma cell line HPB-ALL.
Applications:
FC,IP,WB,FA
Additional Info:
The antibody MEM-262 recognizes an extracellular epitope on beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This
subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Clone number:
MEM-262
Antibody Isotype:
IgG2a
Application Details:
Western blotting: This antibody uniquely recognizes denatured TCR beta chains under the conditions of Western blotting. Functional application: This antibody activates T cells (V beta 5-related subset). Flow cytometry: Recommended dilution: 1-4 µg/ml
The antibody MEM-262 recognizes beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human thymoma cell line HPB-ALL.
Applications:
FC,IP,WB,FA
Additional Info:
The antibody MEM-262 recognizes an extracellular epitope on beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This
subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Clone number:
MEM-262
Antibody Isotype:
IgG2a
Application Details:
Western blotting: This antibody uniquely recognizes denatured TCR beta chains under the conditions of Western blotting. Functional application: This antibody activates T cells (V beta 5-related subset). Flow cytometry: Recommended dilution: 1-4 µg/ml
The antibody MEM-262 recognizes beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human thymoma cell line HPB-ALL.
Applications:
FC,IP,WB
Additional Info:
The antibody MEM-262 recognizes an extracellular epitope on beta chains of the TCR expressed by HPB-ALL cell line [carrying V(beta5.3)] and a small subset of peripheral blood T cells. This
subset is larger than that recognized by other V(beta5.3)-specific antibodies.
Clone number:
MEM-262
Antibody Isotype:
IgG2a
Application Details:
Western blotting: This antibody uniquely recognizes denatured TCR beta chains under the conditions of Western blotting. Flow cytometry: Recommended dilution: 1-4 µg/ml
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IHC,FA
Additional Info:
The mouse monoclonal antibody B1 (also known as B1.1) recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC,IHC
Additional Info:
The mouse monoclonal antibody B1 (also known as B1.1) recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody B1 (also known as B1.1) recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
Clone number:
B1
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody B1 (also known as B1.1) recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
Clone number:
B1
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody B1 (also known as B1.1) recognizes an extracellular epitope of TCR gamma/delta, the subtype of T cell receptor expressed mainly in epithelial tissues and at the sites of infection.
Clone number:
B1
Antibody Isotype:
IgG1 k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests.
Alpha-beta T cell receptors (TCRs) are antigen specific receptors, which are essential to the immune response and are present on the cell surface of T lymphocytes. They recognize peptide-loaded major histocompatibility complexes (pMHCs), that are displayed by antigen presenting cells (APCs). Binding of alpha-beta TCR to pMHC initiates TCR-CD3 clustering on the cell surface and intracellular activation of LCK, that phosphorylates the ITAM motifs of CD3gamma, CD3delta, CD3epsilon and CD3zeta, enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium signaling, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NFkappaB (NF-kB) pathways, leading to the mobilization of transcription factors, that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated by V-D-J-C rearrangements. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MHC restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TCRs with the pMHCs shapes TCR structural and functional avidity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
thymus, spleen, and mesenteric lymph nodes isolated from a mouse transgenic for human TCR Vbeta3Cbeta1
Applications:
FC,IP,IHC
Additional Info:
The mouse monoclonal antibody JOVI.1 recognizes an extracellular epitope on TCR Cbeta1 (TRBC1).
Alpha-beta T cell receptors (TCRs) are antigen specific receptors, which are essential to the immune response and are present on the cell surface of T lymphocytes. They recognize peptide-loaded major histocompatibility complexes (pMHCs), that are displayed by antigen presenting cells (APCs). Binding of alpha-beta TCR to pMHC initiates TCR-CD3 clustering on the cell surface and intracellular activation of LCK, that phosphorylates the ITAM motifs of CD3gamma, CD3delta, CD3epsilon and CD3zeta, enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium signaling, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NFkappaB (NF-kB) pathways, leading to the mobilization of transcription factors, that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated by V-D-J-C rearrangements. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MHC restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TCRs with the pMHCs shapes TCR structural and functional avidity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
thymus, spleen, and mesenteric lymph nodes isolated from a mouse transgenic for human TCR Vbeta3Cbeta1
Applications:
FC
Additional Info:
The mouse monoclonal antibody JOVI.1 recognizes an extracellular epitope on TCR Cbeta1 (TRBC1).
Clone number:
JOVI.1
Antibody Isotype:
IgG2a k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
Alpha-beta T cell receptors (TCRs) are antigen specific receptors, which are essential to the immune response and are present on the cell surface of T lymphocytes. They recognize peptide-loaded major histocompatibility complexes (pMHCs), that are displayed by antigen presenting cells (APCs). Binding of alpha-beta TCR to pMHC initiates TCR-CD3 clustering on the cell surface and intracellular activation of LCK, that phosphorylates the ITAM motifs of CD3gamma, CD3delta, CD3epsilon and CD3zeta, enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium signaling, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NFkappaB (NF-kB) pathways, leading to the mobilization of transcription factors, that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated by V-D-J-C rearrangements. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MHC restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TCRs with the pMHCs shapes TCR structural and functional avidity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
thymus, spleen, and mesenteric lymph nodes isolated from a mouse transgenic for human TCR Vbeta3Cbeta1
Applications:
FC
Additional Info:
The mouse monoclonal antibody JOVI.1 recognizes an extracellular epitope on TCR Cbeta1 (TRBC1).
Clone number:
JOVI.1
Antibody Isotype:
IgG2a k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests.
Alpha-beta T cell receptors (TCRs) are antigen specific receptors, which are essential to the immune response and are present on the cell surface of T lymphocytes. They recognize peptide-loaded major histocompatibility complexes (pMHCs), that are displayed by antigen presenting cells (APCs). Binding of alpha-beta TCR to pMHC initiates TCR-CD3 clustering on the cell surface and intracellular activation of LCK, that phosphorylates the ITAM motifs of CD3gamma, CD3delta, CD3epsilon and CD3zeta, enabling the recruitment of ZAP70. In turn, ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium signaling, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NFkappaB (NF-kB) pathways, leading to the mobilization of transcription factors, that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated by V-D-J-C rearrangements. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MHC restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TCRs with the pMHCs shapes TCR structural and functional avidity.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
thymus, spleen, and mesenteric lymph nodes isolated from a mouse transgenic for human TCR Vbeta3Cbeta1
Applications:
FC
Additional Info:
The mouse monoclonal antibody JOVI.1 recognizes an extracellular epitope on TCR Cbeta1 (TRBC1).
Clone number:
JOVI.1
Antibody Isotype:
IgG2a k
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Recommended dilution: 2-4 ?g/ml; positive control: human peripheral blood T cells.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 20 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (2 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 20 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (2 ml) is sufficient for 100 tests.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Recommended dilution: 2-3 ?g/ml; positive control: human peripheral blood T cells.
The antigen-specific T cell receptor (TCR) is composed of either alpha and beta subunit, or gamma and delta subunit. Majority of T cells present in the blood, lymph and secondary lymphoid organs express TCR alpha/beta heterodimers, whereas the T cells expressing TCR gamma/delta heterodimers are localized mainly in epithelial tissues and at the sites of infection. The subunits of TCR heterodimers are covalently bonded and in the endoplasmic reticulum they associate with CD3 subunits to form functional TCR-CD3 complex. Lack of expression of any of the chains is sufficient to stop cell surface expression.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Applications:
FC
Additional Info:
The mouse monoclonal antibody IP26 recognizes a monomorphic extracellular determinant of TCR alpha/beta, the dominant subtype of T cell receptor expressed in human peripheral blood.
Clone number:
IP26
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests.
SUSD2 (sushi domain containing protein 2) is a type I transmembrane protein, that serves as an important marker of bone marrow-derived mesenchymal stem-like cells (bone marrow stromal cells). These pluripotent cells are important for techniques of autologous cell therapy, and can be collected from e.g. endometrium, or palatine tonsil. SUSD2 seems to be a tumor supresor, and is down-regulated in colon cancer tissues, whereas it is highly expressed e.g. in breast cancer.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody W5C5 recognizes an extracellular epitope of SUSD2, a type I transmembrane protein expressed on mesenchymal stem-like cells. This antibody selectively binds to a MSCs in both bone marrow and endometrium or tonsil, and can be used for their identification and isolation.
SUSD2 (sushi domain containing protein 2) is a type I transmembrane protein, that serves as an important marker of bone marrow-derived mesenchymal stem-like cells (bone marrow stromal cells). These pluripotent cells are important for techniques of autologous cell therapy, and can be collected from e.g. endometrium, or palatine tonsil. SUSD2 seems to be a tumor supresor, and is down-regulated in colon cancer tissues, whereas it is highly expressed e.g. in breast cancer.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody W5C5 recognizes an extracellular epitope of SUSD2, a type I transmembrane protein expressed on mesenchymal stem-like cells. This antibody selectively binds to a MSCs in both bone marrow and endometrium or tonsil, and can be used for their identification and isolation.
SUSD2 (sushi domain containing protein 2) is a type I transmembrane protein, that serves as an important marker of bone marrow-derived mesenchymal stem-like cells (bone marrow stromal cells). These pluripotent cells are important for techniques of autologous cell therapy, and can be collected from e.g. endometrium, or palatine tonsil. SUSD2 seems to be a tumor supresor, and is down-regulated in colon cancer tissues, whereas it is highly expressed e.g. in breast cancer.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
ICC,FC
Additional Info:
The mouse monoclonal antibody W5C5 recognizes an extracellular epitope of SUSD2, a type I transmembrane protein expressed on mesenchymal stem-like cells. This antibody selectively binds to a MSCs in both bone marrow and endometrium or tonsil, and can be used for their identification and isolation.
STRO-1 is a cell surface antigen expressed by stromal elements in human bone marrow, identified by monoclonal antibody STRO-1. Approximately 10% of mononuclear cells, greater than 95% of which are nucleated erythroid precursors, are STRO-1 positive, whereas the CFU-GM (colony-forming unit granulocyte-macrophage), BFU-E (erythroid burst) and CFU-Mix (mixed colonies) committed progenitor cells are negative. CFU-F (fibroblast colony-forming cells) are present exclusively in the STRO-1 positive population. When plated under long-term bone marrow culture conditions, STRO-1 positive cells generate adherent cell layers containing multiple stromal cell types, including adipocytes, smooth muscle cells, osteoblasts, chondrocytes, and fibroblastic elements. In combination with glycophorin A, STRO-1 is a useful marker for identification of mesenchymal stem cells. STRO-1 and CD117 are markers for osteosarcoma cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human CD34 positive bone marrow cells
Applications:
FC,ICC
Additional Info:
The mouse monoclonal antibody STRO-1 recognizes an extracellular epitope of the cell surface antigen STRO-1 expressed by bone marrow mesenchymal stromal cells and nucleated erythroid precursors, but not by committed hematopoietic progenitors.
STRO-1 is a cell surface antigen expressed by stromal elements in human bone marrow, identified by monoclonal antibody STRO-1. Approximately 10% of mononuclear cells, greater than 95% of which are nucleated erythroid precursors, are STRO-1 positive, whereas the CFU-GM (colony-forming unit granulocyte-macrophage), BFU-E (erythroid burst) and CFU-Mix (mixed colonies) committed progenitor cells are negative. CFU-F (fibroblast colony-forming cells) are present exclusively in the STRO-1 positive population. When plated under long-term bone marrow culture conditions, STRO-1 positive cells generate adherent cell layers containing multiple stromal cell types, including adipocytes, smooth muscle cells, osteoblasts, chondrocytes, and fibroblastic elements. In combination with glycophorin A, STRO-1 is a useful marker for identification of mesenchymal stem cells. STRO-1 and CD117 are markers for osteosarcoma cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Human CD34 positive bone marrow cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody STRO-1 recognizes an extracellular epitope of the cell surface antigen STRO-1 expressed by bone marrow mesenchymal stromal cells and nucleated erythroid precursors, but not by committed hematopoietic progenitors.
STRO-1 is a cell surface antigen expressed by stromal elements in human bone marrow, identified by monoclonal antibody STRO-1. Approximately 10% of mononuclear cells, greater than 95% of which are nucleated erythroid precursors, are STRO-1 positive, whereas the CFU-GM (colony-forming unit granulocyte-macrophage), BFU-E (erythroid burst) and CFU-Mix (mixed colonies) committed progenitor cells are negative. CFU-F (fibroblast colony-forming cells) are present exclusively in the STRO-1 positive population. When plated under long-term bone marrow culture conditions, STRO-1 positive cells generate adherent cell layers containing multiple stromal cell types, including adipocytes, smooth muscle cells, osteoblasts, chondrocytes, and fibroblastic elements. In combination with glycophorin A, STRO-1 is a useful marker for identification of mesenchymal stem cells. STRO-1 and CD117 are markers for osteosarcoma cells.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Human CD34 positive bone marrow cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody STRO-1 recognizes an extracellular epitope of the cell surface antigen STRO-1 expressed by bone marrow mesenchymal stromal cells and nucleated erythroid precursors, but not by committed hematopoietic progenitors.
STAT1 (signal transducer and activator of transcription 1) is a transcription factor that plays important roles in growth arrest, apoptosis promoting and tumour suppression. After ligation of cytokine receptors STAT1 becomes phosphorylated on Tyr701 by Janus kinase JAK1 or JAK2, dimerizes, translocates to nucleus and contacts DNA. STAT1-STAT2 heterodimers serve as more potent transcriptional inducers than STAT1 homodimers. STAT1 is also phosphorylated on Ser727 by MAPK pathway, independently of tyrosine phosphorylation. However, the both modifications are important for its maximal transcriptional activity. On the other hand, STAT1 phosphorylated on Ser727 is targeted for proteasomal degradation.
SIGLEC8 is a sialic acid binding lectin similar to CD33. In its cytoplasmic comain it contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), and a motive similar to a binding site for SLAM-associated protein. SIGLEC8 is expressed e.g. in lymph nodes and spleen. It is an eosinophil marker, although it can be found also on the surface of mast cells. Crosslinking of SIGLEC8 leads to apoptosis. Soluble form of SIGLEC8 can be foud in human serum, especially in case of eosinophil-associated diseases.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Extracellular domain of human SIGLEC8 fused with Fc fragment of human IgG1
Applications:
FC,ELISA,IP
Additional Info:
The mouse monoclonal antibody 7C9 recognizes an extracellular epitope of SIGLEC8, an eosinophil marker, expressed e.g. in lymph nodes and spleen.
SIGLEC8 is a sialic acid binding lectin similar to CD33. In its cytoplasmic comain it contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), and a motive similar to a binding site for SLAM-associated protein. SIGLEC8 is expressed e.g. in lymph nodes and spleen. It is an eosinophil marker, although it can be found also on the surface of mast cells. Crosslinking of SIGLEC8 leads to apoptosis. Soluble form of SIGLEC8 can be foud in human serum, especially in case of eosinophil-associated diseases.
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Extracellular domain of human SIGLEC8 fused with Fc fragment of human IgG1
PODXL is a highly glycosylated sialomucin, which is expressed in many types of tumors, as well as it is a well known marker of embryonic stem cells. Overexpression of PODXL is an independent predictor of cancer progression, metastasis, and poor outcome. PODXL promotes tumor growts and invasiveness, and is a potential target for antibody therapy.
PDPN (podoplanin) is a type I transmembrane glycoprotein of mucin-type character. The specific function of this protein has not been determined, but its homologs in other species were described as differentiation antigens. PDPN can be used as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified.
The tumour suppressor protein p53 is a key element of intracellular anticancer protection. It mediates cell cycle arrest or apoptosis in response to DNA damage or to starvation for pyrimidine nukleotides. It is up-regulated in response to these stress signals and stimulated to activate transcription of specific genes, resulting in expression of p21waf1 and other proteins involved in G1 or G2/M arrest, or proteins that trigger apoptosis, such as Bcl-2. The structure of p53 comprises N-terminal transactivation domain, central DNA-binding domain, oligomerisation domain, and C-terminal regulatory domain. There are various phosphorylation sites on p53, of which the phosphorylation at Ser15 is important for p53 activation and stabilization.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
KLH-conjugated phosphopeptide RHKKLMFKTEGPDS[P]D, corresponding to amino acids 378-393 of human p53.
Applications:
WB,IHC
Additional Info:
The mouse monoclonal antibody FP3.2 [FPS392] reacts with human p53 tumour suppressor intracellular protein phosphorylated at CKII site (Ser 392).
Clone number:
FP3.2 [FPS392]
Antibody Isotype:
IgG1
Application Details:
Immunohistochemistry (paraffin sections): Standard ABC technique (DAB+), pretreatment: high temperature antigen retrieval (microwave, pressure cooker) in 10 mM citrate buffer pH 6.0 or 1 mM EDTA-NaOH buffer pH 8.0, recommended dilution: 10 ?g/ml, incubation: 1 hour at RT; or overnight at 4°C, positive tissue: breast carcinoma with high level of wild-type p53. Western blotting: recommended dilution: 1 ?g/ml.
NKp80, also known as CLEC5C or KLRF1, is a type II transmembrane glycoprotein of the C lectin family, which is expressed in 80 kDa homodimers on NK cells, and subsets of CD8+ alpha/beta T cells, and gamma/delta T cells. It belongs to the activating coreceptors, which induce cytotoxicity, and production of pro-inflammatory cytokines. Its ligand AICL is expressed on myeloid cells.
Myeloperoxidase (MPO) is a heme enzyme that is localized in azurophilic (primary) granules of myeloid cells and its synthesis occurs at an early stage of differentiation. The mature myeloperoxidase is a tetramer composed of two light (12 kDa) and two heavy (60 kDa) chains. This enzyme uses hydrogen peroxide to oxidize numerous substrates, including serotonin, melatonin or chloride, to produce reactive free radicals that contribute to immune reactions of myeloid cells against pathogens. Myeloperoxidase functions not only in host defense by mediating efficient microbial killing but also can contribute to progressive tissue damage in chronic inflammatory states such as atherosclerosis or acute pancreatitis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Human myeloperoxidase
Applications:
FC,ELISA
Additional Info:
The mouse monoclonal antibody MPO421-8B2 recognizes human myeloperoxidase, a heme protein present in intracellular granules of myeloblasts, neutrophils and monocytes. It is a marker of acute myelogenous leukemias and acute lymphoblastic leukemias.
Myeloperoxidase (MPO) is a heme enzyme that is localized in azurophilic (primary) granules of myeloid cells and its synthesis occurs at an early stage of differentiation. The mature myeloperoxidase is a tetramer composed of two light (12 kDa) and two heavy (60 kDa) chains. This enzyme uses hydrogen peroxide to oxidize numerous substrates, including serotonin, melatonin or chloride, to produce reactive free radicals that contribute to immune reactions of myeloid cells against pathogens. Myeloperoxidase functions not only in host defense by mediating efficient microbial killing but also can contribute to progressive tissue damage in chronic inflammatory states such as atherosclerosis or acute pancreatitis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Human myeloperoxidase
Applications:
FC
Additional Info:
The mouse monoclonal antibody MPO421-8B2 recognizes human myeloperoxidase, a heme protein present in intracellular granules of myeloblasts, neutrophils and monocytes. It is a marker of acute myelogenous leukemias and acute lymphoblastic leukemias.
Clone number:
MPO421-8B2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 10 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (1 ml) is sufficient for 100 tests. Intracellular staining.
Myeloperoxidase (MPO) is a heme enzyme that is localized in azurophilic (primary) granules of myeloid cells and its synthesis occurs at an early stage of differentiation. The mature myeloperoxidase is a tetramer composed of two light (12 kDa) and two heavy (60 kDa) chains. This enzyme uses hydrogen peroxide to oxidize numerous substrates, including serotonin, melatonin or chloride, to produce reactive free radicals that contribute to immune reactions of myeloid cells against pathogens. Myeloperoxidase functions not only in host defense by mediating efficient microbial killing but also can contribute to progressive tissue damage in chronic inflammatory states such as atherosclerosis or acute pancreatitis.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Human myeloperoxidase
Applications:
FC
Additional Info:
The mouse monoclonal antibody MPO421-8B2 recognizes human myeloperoxidase, a heme protein present in intracellular granules of myeloblasts, neutrophils and monocytes. It is a marker of acute myelogenous leukemias and acute lymphoblastic leukemias.
Clone number:
MPO421-8B2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: The reagent is designed for analysis of human blood cells using 4 ?l reagent / 100 ?l of whole blood or 106 cells in a suspension. The content of a vial (0.4 ml) is sufficient for 100 tests. Intracellular staining.
LOX1, a 31 kDa type II transmembrane protein, is a C-type lectin, functioning as a scavenger receptor for e.g. oxidized low density lipoprotein, apoptotic heat shock proteins, or CRP. It is expressed by macrophages, fibroblasts, platelets, endothelial cells, and smooth muscle cells, and its defects can lead to atherosclerosis. Its expression is enhanced under inflammatory conditions. Multiple splicing variants have been identified.
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
fusion protein of human LOX1 ectodomain and of human IgG Fc
LAR is a receptore-linked transmembrane protein tyrosine phosphatase expressed on mesenchymal stem cells, that reside e.g. in bone marrow, blood, placenta, adipose tissue, or skin, as well as it is expressed on some carcinoma cell lines, including HeLa, MCF-7, or HT29. During the process of externalization, LAR is intracellularly proteolytically processed into two non-covalently associated subunits. This protein is involved in intercellular and cell-matrix interactions and its extracellular part resembles that of cell adhesion molecules (CAMs). The extracellular part can be released from the surface, which may be used for regulation of LAR function.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody W7C6 recognizes an extracellular epitope of protein tyrosine phosphatase LAR, a marker of mesenchymal stem cells.
LAR is a receptore-linked transmembrane protein tyrosine phosphatase expressed on mesenchymal stem cells, that reside e.g. in bone marrow, blood, placenta, adipose tissue, or skin, as well as it is expressed on some carcinoma cell lines, including HeLa, MCF-7, or HT29. During the process of externalization, LAR is intracellularly proteolytically processed into two non-covalently associated subunits. This protein is involved in intercellular and cell-matrix interactions and its extracellular part resembles that of cell adhesion molecules (CAMs). The extracellular part can be released from the surface, which may be used for regulation of LAR function.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody W7C6 recognizes an extracellular epitope of protein tyrosine phosphatase LAR, a marker of mesenchymal stem cells.
LAR is a receptore-linked transmembrane protein tyrosine phosphatase expressed on mesenchymal stem cells, that reside e.g. in bone marrow, blood, placenta, adipose tissue, or skin, as well as it is expressed on some carcinoma cell lines, including HeLa, MCF-7, or HT29. During the process of externalization, LAR is intracellularly proteolytically processed into two non-covalently associated subunits. This protein is involved in intercellular and cell-matrix interactions and its extracellular part resembles that of cell adhesion molecules (CAMs). The extracellular part can be released from the surface, which may be used for regulation of LAR function.
Product Type:
Antibodies Primary
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
WERI-RB-1 retinoblastoma cells
Applications:
FC
Additional Info:
The mouse monoclonal antibody W7C6 recognizes an extracellular epitope of protein tyrosine phosphatase LAR, a marker of mesenchymal stem cells.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Purified human IgM.
Applications:
WB,ICC,ELISA,FC
Additional Info:
The antibody CH2 reacts with Fc fragment of human IgM.
Clone number:
CH2
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml.Flow cytometry: Recommended dilution: 1-4 ?g/ml, extracellular and intracellular staining.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
IgM from human serum.
Applications:
ELISA
Additional Info:
The antibody MA2 reacts with µ-chain of human IgM, Fab - region localized epitope.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Purified human IgM.
Applications:
FC
Additional Info:
The antibody CH2 reacts with Fc fragment of human IgM.
Clone number:
CH2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Recommended dilution: 1-4 ?g/ml. Extracellular and intracellular staining.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Purified human IgM.
Applications:
WB,ELISA
Additional Info:
The antibody CH2 reacts with Fc fragment of human IgM.
Clone number:
CH2
Antibody Isotype:
IgG1
Application Details:
Western blotting: Recommended dilution: 1 ?g/ml.Flow cytometry: Recommended dilution: 1-4 ?g/ml, extracellular and intracellular staining.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Purified human IgM.
Applications:
FC
Additional Info:
The antibody CH2 reacts with Fc fragment of human IgM.
Clone number:
CH2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Recommended dilution: 1-5 ?g/ml. Extracellular and intracellular staining.
Immunoglobulin M (IgM) is produced as a 900 kDa pentamer, which is an efficient complement binder. This antibody type is produced initially in the immune response and it is the first immunoglobulin class to be synthesized by a fetus or newborn. IgM antibodies do not cross the placenta. IgM concentration in blood is 0.12 g/l and its biological survival (plasma T1/2) is 5 days.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Protect from prolonged exposure to light. Do not freeze.
Immunogen:
Purified human IgM.
Applications:
FC
Additional Info:
The antibody CH2 reacts with Fc fragment of human IgM.
Clone number:
CH2
Antibody Isotype:
IgG1
Application Details:
Flow cytometry: Recommended dilution: 1-4 ?g/ml. Extracellular and intracellular staining.
Immunoglobulin G (IgG) is a 150 kDa soluble protein that serves as a major effector molecule of the humoral immune response in man. Its concentration in blood plasma of healthy individuals is approximately 10 g/l, which accounts for about 75% of the total plasma immunoglobulins. IgG has the highest stability of blood immunoglobulins (T1/2 = 21 days) and is able of placental transfer. IgG is secreted by plasma cells at a comparably high rate as other immunoglobulins.
Product Type:
Antibodies Primary
Antibody Type:
monoclonal
Storage Temp:
Store at 2-8°C. Do not freeze.
Immunogen:
Fusion protein of human IgG Fc fragment.
Applications:
WB,ICC,ELISA,FC
Additional Info:
The mouse monoclonal antibody EM-07 reacts with Fc part of human IgG heavy chain and with isolated Fc fragments.
Clone number:
EM-07
Antibody Isotype:
IgG1
Application Details:
Western blotting and ELISA: The peroxidase conjugate of this antibody is suitable for detection of human IgG Fc fragments. The antibody EM-07 does not crossreact with IgM.
HQ-O Ready-To-Dilute (RTD TM ) Stain Reagent is designed to label amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections. As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining. HQ-O RTD TM staining reagent is compatible with other fluorophores, such as DAPI, Hoechst and ethidium bromide, as well as fluorescent-labelled antibodies with emission spectra in the blue and/or red emission range of fluorescent microscopes. Due to its zinc-chelating characteristics, HQ-O RTD TM staining reagent may visualize globular structures within blood vessels and intravascular leucocytes. HQ-O RTD TM staining reagent has multiple advantages over older blue-light exciting stains such as Thioflavin S. Thioflavin S typically exhibits relatively low contrast and resolution and suffers from bleed-through when excited by wavelengths other than blue light. HQ-O RTD TM staining reagent suffers none of these setbacks and not only provides a higher contrast and longer lasting dye, but because it lacks excitation bleed-through, HQ-O can be readily adapted to multiple labelling studies very easily. To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447-503 nm, with a peak at 475.
Background Info:
A novel zinc chelator, HQ-O, was developed for localizing zinc within amyloid plaques. The histology involves incubating tissue sections in a dilute aqueous solution of HQ-O.
Detection and fluorescent-staining of amyloid plaques in paraffin-embedded or freshly cut frozen tissue sections, please see detailed protocol for specific use instructions.
Alternative Names:
HQ-O tracer
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
To visualize the HQ-O tracer, it is recommended to use a filter cube designed for visualizing Fluorescein/FITC or a blue-light laser. Although it can be seen with both narrow and wide-band pass filters, there is no need to use a narrow band filter since the compound does not bleed through when excited with other filters. A recommended excitation range of a wide band filter is 447 503 nm, with a peak at 475 nm.
Shelf Life:
6 months after date of receipt (10X stock solution)
Use:
For research use only.
Kit Components:
One bottle containing 40 mL of 10X HQ-O RTD TM solution This quantity will be sufficient for approximately 8 Coplin Jars or 2-4 staining dishes.
Specificity:
As a fluorescent zinc chelator, HQ-O is unique as it takes advantage of the known presence of concentrated zinc in amyloid plaques. Studies with HQ-O revealed that fluorescent plaque-like structures are only seen when synthetic A?x-42 is aggregated in the presence of zinc. Under blue light excitation, plaque structures appear bright green fluorescent in the brain parenchyma, correlating closely with plaque structures observed following A? antibody staining.
Storage:
Store 10X stock solution at 2-8°C protected from light, for up to 6 months. The diluted dye (1X) should be used within 24 hours.
The Biosensis AG-400-AG kit utilizes an ethidium bromide counter stain for a quick and effective way to visualize cell nuclei and cell bodies of cells while under UV illumination allowing the assessment of amyloid plaques and cell/tissue positioning as well in one step. Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol. EtBr counter stain stains nuclei and cell bodies for easy identification and spacial orientation.
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed. <br>Visualization of EtBr: Ethidium bromide has an excitation peak of 300 nm and an emission peak 595 nm. Most UV compatible filter sets can be used.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
1 bottle containing 40 mL of 10X Amylo-Glo RTD (A-G RTD) solution 1 bottle containing 40 mL of 10X A-G RTD Ethidium Bromide (EtBr RTD) solution
Product references:
Su IJ et al. (2021) "The Beneficial Effects of Combining Anti-A? Antibody NP106 and Curcumin Analog TML-6 on the Treatment of Alzheimer's Disease in APP/PS1 Mice." Int J Mol Sci. 23(1):556; Application: IHC/IF Species: Mouse Emre C et al. (2020) "Receptors for pro-resolving mediators are increased in Alzheimer's disease brain." Brain Pathol. [Epub ahead of print]; Application: IHC/IF Species: Human Hascup KN et al. (2019) "LY379268 Does Not Have Long-Term Procognitive Effects nor Attenuate Glutamatergic Signaling in A?PP/PS1 Mice." J Alzheimers Dis. [Epub ahead of print]; Application: IHC/IF Species: Mouse Hascup ER et al. (2018) "Diet-Induced Insulin Resistance Elevates Hippocampal Glutamate as well as VGLUT1 and GFAP Expression in A?PP/PS1 Mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse
Specificity:
Amyloid plaques both intraneuronal and vascular for A-G, Etbr, nuclei and cell bodies both DNA and RNA label
Storage:
The stock solution can be stored for up to 6 months at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
Amylo-Glo RTD Ready to Dilute Staining reagent is designed to stain amyloid plaques in tissue sections. This novel marker has several advantages over other conventional markers such as Thioflavin S and Congo Red because of its unique chemical and spectral properties. (L. Schmued et al. (2012) J.Neuroscience Methods 209:120- 126). Using Amylo-Glo results in a very bright blue UV excitable stain under physiological conditions that will not bleed through when illuminated with other filters. Its brightness makes it ideal for low magnification quantification studies, while its unique excitation/emission profile and mild staining conditions makes it ideal for combination for multiple immunofluorescent labeling studies. Amylo-Glo RTD is compatible with fresh, frozen, and formalin-fixed immunohistochemistry or cytochemistry, and it is particularly good for confocal and multiple labeling because of its high fluorescent intensity and high resistance to photo-bleaching. Moreover because Amylo-Glo fluoresces in the UV channel, double and triple labeling experiments can be performed very easily (see protocol).
Product Type:
Staining Reagent
Format:
The reagents in the Amyloid Plaque Stain Reagent (100x) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
Staining of amyloid plaques in human and animal tissues, see included protocol
Alternative Names:
AmyloGlo
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
Excitation Peak: 334 nm; Emission Peak: 533 nm - unbound, 438 nm when bound to amyloid. To visualize Amylo-glo in tissue, UV light is required. For example, Amylo-Glo tissue can be examined using an epifluoresent microscope with UV (Nikon UV-2A) filter cube. Excitation (325-375 nm) Emission (400-450 nm) is typical. Also note, it is not uncommon for Amylo-Glo to appear light yellow when examined by eye, yet appear a light blue color when photographed.
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
5 mL of 100X Amylo-Glo RTD (A-G RTD) solution
Product references:
Silvin A et al. (2022) "Dual ontogeny of disease-associated microglia and disease inflammatory macrophages in aging and neurodegeneration" Immunity. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shrader JM et al. (2022) "Distinct Brain Proteomic Signatures in Cerebral Small Vessel Disease Rat Models of Hypertension and Cerebral Amyloid Angiopathy" J Neuropathol Exp Neurol. [Epub ahead of print]; Application: IHC/IF Species: Rat Zagorski K et al. (2022) "Immunogenicity of MultiTEP-Platform-Based Recombinant Protein Vaccine, PV-1950R, Targeting Three B-Cell Antigenic Determinants of Pathological ?-Synuclein" Int J Mol Sci. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shabestari SK et al. (2022) "Absence of microglia promotes diverse pathologies and early lethality in Alzheimers disease mice" Cell Rep. 39(11):110961; Application: IHC/IF Species: Mouse Davis J et al. (2022) "rTg-D: A novel transgenic rat model of cerebral amyloid angiopathy Type-2." Cerebral Circulation - Cognition and Behavior [Epub ahead of print]; Application: IHC/IF Species: Rat Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31; Application: IHC/IF Species: Human Javonillo DI et al. (2022) "Systematic Phenotyping and Characterization of the 3xTg-AD Mouse Model of Alzheimer's Disease." Front Neurosci. 15:785276; Application: IHC/IF Species: Mouse Hohsfield LA et al. (2022) "MAC2 is a long-lasting marker of peripheral cell infiltrates into the mouse CNS after bone marrow transplantation and coronavirus infection." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Tsay HJ et al. (2021) "EK100 and Antrodin C Improve Brain Amyloid Pathology in APP/PS1 Transgenic Mice by Promoting Microglial and Perivascular Clearance Pathways." Int J Mol Sci. 22(19):10413; Application: IHC/IF Species: Mouse Henningfield CM et al. (2021) "Microglia-specific ApoE knock-out does not alter Alzheimer's disease plaque pathogenesis or gene expression." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Da Mesquita S et al. (2021) "Meningeal lymphatics affect microglia responses and anti-A? immunotherapy." Nature. 593(7858):255-260; Application: IHC/IF Species: Mouse Lauterborn JC et al. (2021) "Increased excitatory to inhibitory synaptic ratio in parietal cortex samples from individuals with Alzheimer's disease. Nat Commun. 12(1):2603; Application: IHC/IF Species: Human Kim JH et al. (2021) "Gamma subunit of complement component 8 is a neuroinflammation inhibitor." Brain. 144(2):528-552; Application: IHC/IF Species: Mouse Claes C et al. (2021) "Plaque-associated human microglia accumulate lipid droplets in a chimeric model of Alzheimer's disease." Mol Neurodegener. 16(1):50; Application: IHC/IF Species: Mouse Crapser JD. (2021) "Investigating microglial regulation of the extracellular matrix in health and neurodegenerative disease." PhD Thesis ; Application: IHC/IF Species: Human Baglietto-Vargas D et al. (2021) "Generation of a humanized A? expressing mouse demonstrating aspects of Alzheimer's disease-like pathology." Nature Communications. 2(1):2421; Application: IHC/IF Species: Mouse Mistrik M et al. (2021) "Microthermal-induced subcellular-targeted protein damage in cells on plasmonic nanosilver-modified surfaces evokes a two-phase HSP-p97/VCP response." Nature Communications. 12, Article Number 719; Application: ICC/IF Species: Human Lemoine L et al. (2020) "Regional binding of tau and amyloid PET tracers in Down syndrome autopsy brain tissue." Mol Neurodegener. 15(1):68; Application: IHC/IF Species: Human Hascup KN et al. (2020) "Riluzole attenuates glutamatergic tone and cognitive decline in A?PP/PS1 mice." J Neurochem. [Epub ahead of print]; Application: IHC/IF Species: Mouse Holloway OG et al. (2020) "Microglia Demonstrate Local Mixed Inflammation and a Defined Morphological Shift in an APP/PS1 Mouse Model. J Alzheimers Dis. 77(4):1765-81; Application: IHC/IF Species: Mouse McQuade A et al. (2020) "Gene expression and functional deficits underlie TREM2-knockout microglia responses in human models of Alzheimer s disease. Nat Commun. 11(1):5370; Application: IHC/IF Species: Mouse Hascup KN et al. (2020) "Hippocampal alterations in glutamatergic signaling during amyloid progression in A?PP/PS1 mice." Sci Rep. 10(1):14503; Application: IHC/IF Species: Mouse Crapser JD et al. (2020) "Microglia facilitate loss of perineuronal nets in the Alzheimer's disease brain." EBioMedicine. 58:102919; Application: IHC/IF Species: Mouse Abe Y et al. (2020) "Behavioral and electrophysiological evidence for a neuroprotective role of aquaporin-4 in the 5xFAD transgenic mice model." Acta Neuropathol Commun. 8(1):67; Application: IHC/IF Species: Mouse Zhu X et al. (2020) "Robust neuroinflammation and perivascular pathology in rTg-DI rats, a novel model of microvascular cerebral amyloid angiopathy." J Neuroinflammation. 17(1):78; Application: IHC/IF Species: Rat Majewski L et al. (2020) "Transgenic Mice Overexpressing Human STIM2 and ORAI1 in Neurons Exhibit Changes in Behavior and Calcium Homeostasis but Show No Signs of Neurodegeneration." Int J Mol Sci. 21(3); Application: IHC/IF Species: Mouse Davtyan H et al. (2019) "Testing a MultiTEP-based combination vaccine to reduce A? and tau pathology in Tau22/5xFAD bigenic mice." Alzheimers Res Ther. 11(1):107; Application: IHC/IF Species: Mouse Yeh SHH et al. (2019) "A high-sucrose diet aggravates Alzheimer's disease pathology, attenuates hypothalamic leptin signaling, and impairs food-anticipatory activity in APPswe/PS1dE9 mice." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Mouse Bharani KL et al. (2019) "Serum Pro-Bdnf Levels Correlate With Phospho-Tau Staining In Alzheimer's Disease." Neurbiol. Aging. [In press]; Application: IHC/IF Species: Human Hovakimyan A et al. (2019) "A MultiTEP platform-based epitope vaccine targeting the phosphatase activating domain (PAD) of tau: therapeutic efficacy in PS19 mice." Sci Rep. 9(1):15455; Application: IHC/IF Species: Human Hasselmann J et al. (2019) "Development of a Chimeric Model to Study and Manipulate Human Microglia In Vivo." Neuron. [Epub ahead of print]; Application: IHC/IF Species: Mouse Spangenberg E et al. (2019) "Sustained microglial depletion with CSF1R inhibitor impairs parenchymal plaque development in an Alzheimer's disease model." Nat Commun. 10(1):3758 (Supplementary Figure 1); Application: IHC/IF Species: Human Eggers C et al. (2019) "Novel cannabis flavonoid, cannflavin A displays both a hormetic and neuroprotective profile against amyloid _-mediated neurotoxicity in PC12 cells: comparison with geranylated flavonoids, mimulone and diplacone." Biochem Pharmacol. [Epub ahead of print]; Application: IHC/IF Species: Rat Dominguez E (2019) "Microglial Contributions to Alzheimer's Disease Pathogenesis." PhD Thesis, UC Irvine. Application: IHC/IF Species: Mouse Jovic M et al. (2019) "Short-term fish oil supplementation applied in presymptomatic stage of Alzheimer's disease enhances microglial/macrophage barrier and prevents neuritic dystrophy in parietal cortex of 5xFAD mouse model." PLoS One. 14(5):e0216726; Application: IHC/IF Species: Mouse Collins MJ et al. (2019) "Age moderates the effects of traumatic brain injury on beta-amyloid plaque load in APP/PS1 mice." J Neurotrauma. [Epub ahead of print]; Application: IHC/IF Species: Mouse Shukla AK et al. (2018) "CD11a expression distinguishes infiltrating myeloid cells from plaque-associated microglia in Alzheimer's disease." Glia. [Epub ahead of print]; Application: IHC/IF Species: Mouse Feng X et al. (2018) "Quantitative proteomics reveals distinct composition of amyloid plaques in Alzheimer's disease." Alzheimers Dement. [In press]; Application: IHC/IF Species: Human, mouse Davis J et al. (2018) "A Novel Transgenic Rat Model of Robust Cerebral Microvascular Amyloid with Prominent Vasculopathy." Am J Pathol. [Epub ahead of print]; Application: IHC/IF Species: Rat Palombo F et al. (2017) "Detection of A? plaque-associated astrogliosis in Alzheimer's disease brain by spectroscopic imaging and immunohistochemistry." Analyst. [Epub ahead of print]; Application: IF Species: Mouse Abud EM (2017) "Generation of Human Microglia from Induced Pluripotent Stem Cells to Study Innate Immunity in Neurological Diseases." PhD Thesis. 2017; Application: IF Species: Mouse Abud EM et al. (2017) "iPSC-Derived Human Microglia-like Cells to Study Neurological Diseases." Neuron. 2017; 49(2):278-93 Application: IF Species: Mouse Solomon IH et al. (2017) "Brain and liver pathology, amyloid deposition, and interferon responses among older HIV-positive patients in the late HAART era." BMC Infect Dis. 2017; 17(1):151 Application: IF Species: Human Xu F et al. (2016) "Cerebral vascular amyloid seeds drive amyloid _-protein fibril assembly with a distinct anti-parallel structure." Nat Commun. 2016; 7:13527. Application: IF Species: Mouse Katsouri L et al. (2016) "PPARγ-coactivator-1_ gene transfer reduces neuronal loss and amyloid-_ generation by reducing _-secretase in an Alzheimer's disease model ." Proc Natl Acad Sci USA. 2016; 113(43):12292-97. Application: IF Species: Mouse Esposito G et al. (2016) "Autologous transplantation of intestine-isolated glia cells improves neuropathology and restores cognitive deficits in _ amyloid-induced neurodegeneration." Sci Rep. 2016; 6: 22605. Application: IF Species: Rat Marsh SE et al. (2016) "The adaptive immune system restrains Alzheimer's disease pathogenesis by modulating microglial function." Proc Natl Sci USA. Feb 16. pii: 201525466. Application: IF Species: Hu Fibrillar amyloid visualization. Kim YH et al. (2015) "A 3D human neural cell culture system for modeling Alzheimer's disease." Nat Protoc. Jul;10(7):985-1006. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Nijholt DA et al. (2015) "Pregnancy Zone Protein is Increased in the Alzheimer's Disease Brain and Associates with Senile Plaques." J Alzheimer's Disease. 46(1):227-38. Application: IF Species: Hu Kamphuis W et al. (2015) "GFAP and vimentin deficiency alters gene expression in astrocytes and microglia in wild-type mice and changes the transcriptional response of reactive glia in mouse model for Alzheimer's disease." Glia. Jun;63(6):1036-56. Application: IF Species: Mouse Choi SH et al. (2014) "A three-dimensional human neural cell culture model of Alzheimer's disease." Nature Oct 12. doi: 10.1038/nature1380. Application: IF Species: Hu , Human neural stem-cell-derived three-dimensional (3D) culture system. Niedowicz DM et al. (2014). "Obesity and diabetes cause cognitive dysfunction in the absence of accelerated beta-amyloid deposition in a novel murine model of mixed or vascular dementia." Acta Neuropathol Commun. 2014 Jun 10;2:64.
Specificity:
Amyloid plaques both intraneuronal and vascular
Storage:
The stock solution can be stored for up to 6 months after date of receipt at 2-8°C protected from light. No preservatives. Use sterile technique when handling and proper laboratory procedures.
Purification:
Thin layer chromatography using alumina plates and a solvent system of ethanol and water (3:1) revealed the presence of two fluorescent isomers. No amount of starting material was detected.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG325 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade B labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade C, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Silica TLC (acetanitrile/water, 6/4) revealed the presence of 2 fluorescent spots, presumably corresponding to the mono and di sulphate homologues. The presence of precursors or free fluorescein was not detected.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. The fluorescent dye Fluoro-Jade B (FJB), like its more purified brother Fluoro-Jade C (FJC), is an anionic fluorescein derivative useful for the histological staining of neurons undergoing degeneration. Fluoro-Jade B differs from FJC in that it is a slightly less refined chemical formulation and thus it does not quite provide the same level of signal to noise or high resolution as FJC. Nonetheless FJB is still widely used and works very well as a marker of degenerating neurons and even glia (see Damjanac M et al., Brain Res. 2007;1128(1):40-9). FJB operates nearly identically in protocol to that of FJC, and Fluoro-Jade B is compatible with several other labeling procedures including immunofluorescent and fluorescent Nissl techniques. Fluoro-Jade B stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade B exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols. Note: This product is equivalent to discontinued product AG310 from Merck-Millipore.
Product Type:
Staining Reagent
Format:
Dry, Coffee brown to brick red powder; hygroscopic powder keep dessicated.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC
Application Details:
Following our detailed protocol, Fluoro-Jade C labels degenerating neurons which are visualised with blue light excitation, while DAPI (not included) counter stains cell nuclei, visualised with ultra-violet illumination. The Fluoro-Jade C dye can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJB, Fluoro-Jade
Biosensis Brand:
Biosensis®
Detection Method:
Fluorescence
Excitation/Emission:
FJB visualization is accomplished using blue light or a 488 nm Laser. <br>Excitation Peak: 495 nm<br>Emission Peak: 521 nm<br>Filter system for visualizing: Fluorescein/FITC
Shelf Life:
6 months after date of receipt (unopened vial).
Use:
For research use only.
Kit Components:
Materials Provided: 30 mg Fluoro-Jade B, dry powder Detailed protocol Equipment and Reagents Required: Distilled water ACS grade Ethanol (200 proof) for slide & solution preparation 1% sodium hydroxide in 80% ethanol (basic alcohol solution) 0.1% Acetic Acid solution (in water) 70% ethanol in distilled water 0.06% (KMnO4) potassium permanganate solution DAPI powder or 100X solution (working range is 0.5-5 µg/mL) Xylene liquid Staining dishes/Coplin jars Cover slips DPX mounting media or another permanent mounting medium. Non-polar media are preferred over aqueous mounting media such as glycerin/water to obtain high- contrast images (refer to Appendix B in the protocol for a comparative analysis). Traditional fluorescent mounting mediums are not recommended because of their high pH. Slide warmer Convection oven
Product references:
Ikeda A et al. (2022) "Alteration of the neuronal and glial cell profiles in Neu1-deficient zebrafish" Glycoconj ; [Epub ahead of print]; Application: ICC/FC Species: Zebrafish
Choi I et al. (2022) "Interleukin-17A Mediates Hippocampal Damage and Aberrant Neurogenesis Contributing to Epilepsy-Associated Anxiety" Front. Mol. Neurosci. ; [Epub ahead of print]; Application: ICC/FC Species: Mouse
Cui Y et al. (2022) "Modified Citrus Pectin Alleviates Cerebral Ischemia/Reperfusion Injury by Inhibiting NLRP Inflammasome Activation via TLR4/NF-?B Signaling Pathway in Microglia" J Inflamm. Res. ; 15: 3369-3385; Application: ICC/FC Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The powdered dye can be stored desiccated at room temperature in the dark. Storage in a desiccator is recommended as FJB is hydroscopic. The 0.01% stock solution will remain stable for 3 months when stored in a refrigerator, in the dark. The 0.0001-0.0004% working solution in 0.1% acetic acid should be used within 4 hours of preparation. Diluted FJB dye solutions are not stable and should not be stored. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions.
Purification:
Thin layer chromatograpy using cellulose plates and a solvent system of n-propinol, water, and ammonium hydroxide (6:5:2) revealed the presence of two fluorescent isomers and two trace non-fluorescent bands. No amount of fluorescein or Fluoro-Jade was present.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 20 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 20 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 20 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 20 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
The causes and effects of neuronal degeneration are of major interest to a wide variety of neuroscientists. Paralleling this growing interest is an increasing number of methods applicable to the detection of neuronal degeneration. Fluoro-Jade C stains all degenerating neurons regardless of specific insult or mechanism of cell death. Fluoro-Jade C exhibits the greatest signal to background ratio, as well as the highest resolution. This translates to a stain of maximal contrast and affinity for degenerating neurons. This makes it ideal for localising not only degenerating nerve cell bodies but also distal dendrites, axons and terminals. The dye is highly resistant to fading and is compatible with virtually all histological processing and staining protocols.
Product Type:
Staining Reagent
Format:
The reagents in the Fluoro Jade kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Applications:
FC,ICC,IHC-Frozen,IHC-Paraffin-embedded
Application Details:
The Fluoro-Jade C 'Ready to Dilute' (RTD) Staining Kit provides an easy to use assortment of Fluoro-Jade C, DAPI, sodium hydroxide and potassium permanganate in liquid form. Following our detailed protocol, Fluoro-Jade C labelled degenerating neurons are visualised with blue light excitation while DAPI counter stained cell nuclei are visualised with ultra-violet illumination. The Fluoro-Jade C Staining Kit can be used on all kinds of preserved tissues, including fresh-frozen, paraformaldehyde or formalin fixed, and formalin fixed, paraffin-embedded tissues.
Alternative Names:
FJC
Biosensis Brand:
Biosensis® RTD
Detection Method:
Fluorescence
Excitation/Emission:
FJC visualization is accomplished using blue light or a 488 nm Laser. Excitation Peak: 495 nm Emission Peak: 521 nm Filter system for visualizing: Fluorescein/FITC
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Materials provided: Sodium Hydroxide, Solution A (Dilute 1:10 prior to use) - 40 mL Potassium Permanganate, Solution B (Dilute 1:10 prior to use) - 40 mL Fluoro-Jade C, Solution C (Dilute 1:10 prior to use) - 40 mL DAPI, Solution D (Add to diluted Fluoro-Jade C) - 40 mL Equipment and Reagents required: Gelatin coated microscope slides Staining dishes/Coplin jars Cover slips DPX mounting media Slide warmer Convection oven Distilled water Ethanol Xylene Number of slides processed: The actual number of slides processed by this kit will depend largely upon the vessel that is used to incubate the slides. If using a standard Coplin Jar, its capacity is 50 mL and typically holds 5 slides per jar. If using such a device, then 80-100 slides stained per 50 ml of working solution (or, 5 ml of stock solution) could be processed in one day. Note the diluted dye is NOT stable and will not store overnight. It is best to use freshly diluted dye each time an experimental batch is started. Final working concentrations of FJC: 0.0001% Final working concentration of KMnO4: 0.06%
Product references:
Total Number of References: 153 Latest Publications (2020-2022):
Li L et al. (2022) "A selective degeneration of cholinergic neurons mediated by NRADD in an Alzheimer's disease mouse model" Cell Insight. [Epub ahead of print] . Application: IF. Species: Mouse. Karino K et al. (2022) "Inhibitor of nuclear factor kappa-B kinase epsilon contributes to neuropsychiatric manifestations in lupus-prone mice through microglial activation" Arthritis Rheumatol. [Epub ahead of print] . Application: IF. Species: Mouse. Chen J et al. (2022) "Flufenamic acid improves survival and neurologic outcome after successful cardiopulmonary resuscitation in mice" J Neuroinflammation. 19(1):214 . Application: IF. Species: Mouse. Zou Y et al. (2022) "Learning and memory impairment and transcriptomic profile in hippocampus of offspring after maternal fructose exposure during gestation and lactation" Food Chem Toxicol. [Epub ahead of print] . Application: IF. Species: Rat. Jin P et al. (2022) "Aprepitant attenuates NLRC4-dependent neuronal pyroptosis via NK1R/PKC? pathway in a mouse model of intracerebral hemorrhage" J Neuroinflammation. 19(10):198 . Application: IF. Species: Mouse. Koike-Kumagai M et al. (2022) "Sirolimus relieves seizures and neuropsychiatric symptoms via changes of microglial polarity in tuberous sclerosis complex model mice" Neuropharmacology. [Epub ahead of print] . Application: IF. Species: Mouse. Wang D et al. (2022) "Mesenchymal stromal cell treatment attenuates repetitive mild traumatic brain injury-induced persistent cognitive deficits via suppressing ferroptosis" Neuroinflammation. 19(1):185 . Application: IF. Species: Mouse. Seo Y et al. (2022) "Mesenchymal stem cells target microglia via galectin-1 production to rescue aged mice from olfactory dysfunction" Biomed Pharmacother. 153:113347 . Application: IF. Species: Mouse. Duan R et al. (2022) "Recurrent de novo single point variant on the gene encoding Na+/K+ pump results in epilepsy" Prog Neurobiol. 216:102310 . Application: IF. Species: Mouse. Liu P et al. (2022) "Suppression of phosphodiesterase IV enzyme by Roflumilast ameliorates cognitive dysfunction in aged rats after sevoflurane anesthesia via PKA-CREB and MEK/ERK pathways" Eur J Neurosci. [Epub ahead of print] . Application: IF. Species: Rat. Boucher ML et al. (2022) "Titrating the Translational Relevance of a Low-Level Repetitive Head Impact Model" Front Neurol. 13:857654 . Application: IF. Species: Mouse. Qian L et al. (2022) "Interleukin-35 attenuates blood-brain barrier dysfunction caused by cerebral ischemia-reperfusion injury through inhibiting brain endothelial cell injury" Ann Transl Med. 10.21037 . Application: IF. Species: Mouse. Buentello DC et al. (2022) "Use of standard U-bottom and V-bottom well plates to generate neuroepithelial embryoid bodies" PLoS One. 17(5): e0262062 . Application: IF. Species: Human. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3?/Sirt1/PGC-1? Pathway after ICH" Oxid Med Cell Longev. 2022: 7542468 . Application: IF. Species: Mouse. Wang J et al. (2022) "Irisin protects against sepsis-associated encephalopathy by suppressing ferroptosis via activation of the Nrf2/GPX4 signal axis" Free Radic Biol Med. [Epub ahead of print] . Application: IF. Species: Mouse. Tang T et al. (2022) "Ginkgetin Promotes M2 Polarization of Microglia and Exert Neuroprotection in Ischemic Stroke via Modulation of PPAR? Pathway" Neurochem Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhang Z et al. (2022) "Inhibiting Microglia-Derived NLRP3 Alleviates Subependymal Edema and Cognitive Dysfunction in Posthemorrhagic Hydrocephalus after Intracerebral Hemorrhage via AMPK/Beclin-1 Pathway" Oxid. Med. Cell. Longev. [Epub ahead of print] . Application: IF. Species: Rat. Ren R et al. (2022) "Kynurenine/Aryl Hydrocarbon Receptor Modulates Mitochondria-Mediated Oxidative Stress and Neuronal Apoptosis in Experimental Intracerebral Hemorrhage" Antioxid Redox Signal. [Epub ahead of print] . Application: IF. Species: Mouse. Deforzh E et al. (2022) "Promoter and enhancer RNAs regulate chromatin reorganization and activation of miR-10b/HOXD locus, and neoplastic transformation in glioma" Mol Cell. [Epub ahead of print] . Application: IF. Species: Human, Mouse. Chen X et al. (2022) "Mechanism of Baicalein in Brain Injury After Intracerebral Hemorrhage by Inhibiting the ROS/NLRP3 Inflammasome Pathway" Inflammation. 45(2):590-602 . Application: IF. Species: Rat. Komatsu A et al. (2022) "Ammonia induces amyloidogenesis in astrocytes by promoting amyloid precursor protein translocation into the endoplasmic reticulum" J Bio; Chem. [Epub ahead of print] . Application: IF. Species: Mouse. Jin P et al. (2022) "Activation of LRP6 with HLY78 Attenuates Oxidative Stress and Neuronal Apoptosis via GSK3 ?/Sirt1/PGC-1 ? Pathway after ICH" Oxid Med Cell Longev. 7542468 . Application: IF. Species: Mouse. Hong Y et al. (2022) "Ultrasound stimulation improves inflammatory resolution, neuroprotection, and functional recovery after spinal cord injury" Sci Rep. 12(1):3636 . Application: IF. Species: Rat. Li J et al. (2022) "Inhibition of LRRK2-Rab10 Pathway Improves Secondary Brain Injury After Surgical Brain Injury in Rats" Front Surg. 8:749310 . Application: IF. Species: Rat. Yamashima T et al. (2022) "Hydroxynonenal Causes Lysosomal and Autophagic Failure in the Monkey." J Alzheimers Dis Parkinsonism. 12:529 . Application: IF. Species: Monkey. Salvadores N et al. (2022) "A? oligomers trigger necroptosis-mediated neurodegeneration via microglia activation in Alzheimer's disease." Acta Neuropathol Commun. 10(1):31 . Application: IF. Species: Mouse. Shi M et al. (2022) "Downregulation of TREM2/NF-?B signaling may damage the blood-brain barrier and aggravate neuronal apoptosis in experimental rats with surgically injured brain." Brain Res Bull. [Epub ahead of print] . Application: IF. Species: Rat. Zhao Y et al. (2022) "ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimers disease models." Nat Commun. 13(1):1121 . Application: IF. Species: Mouse. Fan X et al. (2022) "Inhibiting Sphingosine 1-Phosphate Receptor Subtype 3 Attenuates Brain Damage During Ischemia-Reperfusion Injury by Regulating nNOS/NO and Oxidative Stress." Front Neurosci. 16:838621 . Application: IF. Species: Mouse. Yu S et al. (2022) "BMS-470539 Attenuates Oxidative Stress and Neuronal Apoptosis via MC1R/cAMP/PKA/Nurr1 Signaling Pathway in a Neonatal Hypoxic-Ischemic Rat Model." Oxid Med Cell Longev. 2022:4054938 . Application: IF. Species: Rat. Kim EC et al. (2021) "Spontaneous seizure and memory loss in mice expressing an epileptic encephalopathy variant in the calmodulin-binding domain of Kv7.2." Proc Natl Acad Sci USA. 118(51):e2021265118 . Application: IF. Species: Mouse. Zhang Y et al. (2021) "GSK-3? inhibition elicits a neuroprotection by restoring lysosomal dysfunction in neurons via facilitation of TFEB nuclear translocation after ischemic stroke." Brain Res. [Epub ahead of print] . Application: IF. Species: Rat. Kondoh D et al. (2021) "Cotton rats (Sigmodon hispidus) with a high prevalence of hydrocephalus without clinical symptoms." Neuropathology. [Epub ahead of print] . Application: IF. Species: Rat. Iwasa K et al. (2021) "A peripheral lipid sensor GPR120 remotely contributes to suppression of PGD2-microglia-provoked neuroinflammation and neurodegeneration in the mouse hippocampus." J Neuroinflammation. 18(1):304 . Application: IF. Species: Mouse. Rodriguez-Masso SR et al. (2021) "The Bradykinin B2 Receptor Agonist (NG291) Causes Rapid Onset of Transient BloodBrain Barrier Disruption Without Evidence of Early Brain Injury." Front Neurosci. 15:791709 . Application: IF. Species: Rat. Li N et al. (2021) "Postcooling But Not Precooling Benefits Motor Recovery by Suppressing Cell Death after Surgical Spinal Cord Injury in Rats." World Neurosurg. [Epub ahead of print] . Application: IF. Species: Rat. Estrada H et al. (2021) "High-resolution fluorescence-guided transcranial ultrasound mapping in the live mouse brain. Sci Adv. 7(50):eabi5464 . Application: IF. Species: Mouse. Gu R et al. (2021) "Rh-CXCL-12 Attenuates Neuronal Pyroptosis after Subarachnoid Hemorrhage in Rats via Regulating the CXCR4/NLRP1 Pathway." Oxid Med Cell Longev. 2021:6966394 . Application: IF. Species: Rat. Huang L et al. (2021) "Docosahexaenoic acid reduces hypoglycemia-induced neuronal necroptosis via the peroxisome proliferator-activated receptor ?/nuclear factor-?B pathway." Brain Res. [Epub ahead of print] . Application: IF. Species: Mouse. Yaguchi A et al. (2021) "Efficient protein incorporation and release by a jigsaw-shaped self-assembling peptide hydrogel for injured brain regeneration." Nat Commun. 12(1):6623 . Application: IF. Species: Mouse. Liu Y et al. (2021) "Neuroprotection of minocycline by inhibition of extracellular matrix metalloproteinase inducer expression following intracerebral hemorrhage in mice." Neurosci Lett. [Epub ahead of print] . Application: IF. Species: Mouse. Lam V et al. (2021) "Synthesis of human amyloid restricted to liver results in an Alzheimer disease-like neurodegenerative phenotype." PLoS Biol. 19(9):e3001358 . Application: IF. Species: Mouse. Wu Z et al. (2021) "Melibiose Confers a Neuroprotection against Cerebral Ischemia/Reperfusion Injury by Ameliorating Autophagy Flux via Facilitation of TFEB Nuclear Translocation in Neurons." Life. 11(9), 948 . Application: IF. Species: Rat. Fang Y et al. (2021) "Pituitary adenylate cyclase-activating polypeptide attenuates mitochondria-mediated oxidative stress and neuronal apoptosis after subarachnoid hemorrhage in rats." Free Radic Biol Med. 174:236-248 . Application: IF. Species: Rat. Huan PS et al. (2021) "3,6'-Dithiopomalidomide Ameliorates Hippocampal Neurodegeneration, Microgliosis and Astrogliosis and Improves Cognitive Behaviors in Rats with a Moderate Traumatic Brain Injury." Int J Mol Sci. 22(15):8276 . Application: IF. Species: Mouse. Han M et al. (2021) "Localized Modification of Water Molecule Transport After Focused Ultrasound-Induced BloodBrain Barrier Disruption in Rat Brain." Front Neurosci. 15:685977 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the p?SPAK/p?NKCC1 signaling pathway protects the blood?brain barrier and reduces neuronal apoptosis in a rat model of surgical brain injury." Mol Med Rep. 24(4):717 . Application: IF. Species: Rat. Zhu L et al. (2021) "Neuroprotective effects of salidroside on ageing hippocampal neurons and naturally ageing mice via the PI3K/Akt/TERT pathway." Phytother Res. [Epub ahead of print] . Application: IF. Species: Mouse. Huang Y et al. (2021) "Kisspeptin-54 attenuates oxidative stress and neuronal apoptosis in early brain injury after subarachnoid hemorrhage in rats via GPR54/ARRB2/AKT/GSK3? signaling pathway." Free Radic Biol Med. 171:99-111 . Application: IF. Species: Rat. Gong Y et al. (2021) "Inhibition of the NKCC1/NF-?B Signaling Pathway Decreases Inflammation and Improves Brain Edema and Nerve Cell Apoptosis in an SBI Rat Model." Front Mol Neurosci. 14:641993 . Application: IF. Species: Rat. Caron NS et al. (2021) "Mutant Huntingtin Is Cleared from the Brain via Active Mechanisms in Huntington Disease." J Neurosci. 41(4):780-796 . Application: IF. Species: Human. Liu L et al. (2021) "A Novel Netrin-1-Derived Peptide Enhances Protection against Neuronal Death and Mitigates of Intracerebral Hemorrhage in Mice." Int J Mol Sci. 22(9):4829 . Application: IF. Species: Mouse. Zalewska K et al. (2021) "Corticosterone Administration Alters White Matter Tract Structure and Reduces Gliosis in the Sub-Acute Phase of Experimental Stroke." Int J Mol Sci. 22(13):6693 . Application: IF. Species: Mouse. Agrawal RR et al. (2021) "Neurometabolic Alterations After Traumatic Brain Injury: Links to Mitochondria-Associated ER Membranes and Alzheimers Disease." PhD Thesis . Application: IF. Species: Mouse. Zhou H et al. (2021) "AXL kinase-mediated astrocytic phagocytosis modulates outcomes of traumatic brain injury." J Neuroinflammation. 18(1):154 . Application: IF. Species: Mouse. Ousta A et al. (2021) "Microglial Activation and Neurological Outcomes in a Murine Model of Cardiac Arrest." Neurocrit Care. [Epub ahead of print] . Application: IF. Species: Mouse. Horinokita H et al. (2021) "Possible involvement of progranulin in the protective effect of elastase inhibitor on cerebral ischemic injuries of neuronal and glial cells." Mol Cell Neurosci. 113:103625 . Application: IF. Species: Human. Ho MH et al. (2021) "CCL5 via GPX1 activation protects hippocampal memory function after mild traumatic brain injury." Redox Biol. 46:102067 . Application: IF. Species: Mouse. Lian C et al. (2021) "Pentraxin 3 secreted by human adipose-derived stem cells promotes dopaminergic neuron repair in Parkinson's disease via the inhibition of apoptosis." FASEB J. 35(7):e21748 . Application: IF. Species: Mouse. Li Z et al. (2021) "The combination of deferoxamine and minocycline strengthens neuroprotective effect on acute intracerebral hemorrhage in rats." Neurol Res. [Epub ahead of print] . Application: IF. Species: Rat. Zhou K et al. (2021) "Dihydrolipoic acid enhances autophagy and alleviates neurological deficits after subarachnoid hemorrhage in rats." Exp Neurol. 342:113752 . Application: IF. Asuni GP et al. (2021) "Neuronal apoptosis induced by morphine withdrawal is mediated by the p75 neurotrophin receptor." J Neurochem. [Epub ahead of print] . Application: IF. Deng S et al. (2021) "Albumin Reduces Oxidative Stress and Neuronal Apoptosis via the ERK/Nrf2/HO-1 Pathway after Intracerebral Hemorrhage in Rats." Oxid. Med. Cell. Longev. 2021, Article ID 8891373 . Application: IF. Wu MY et al. (2021) "Possible mechanisms of the PERK pathway on neuronal apoptosis in a rat model of surgical brain injury." Am J Transl Res. 13(2):732-742 . Application: IF. Cai G et al. (2021) "Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction." Stem Cell Res Ther. 12(1)2 . Application: IF. Xu W et al. (2021) "Melanocortin 1 receptor attenuates early brain injury following subarachnoid hemorrhage by controlling mitochondrial metabolism via AMPK/SIRT1/PGC-1_ pathway in rats." Theranostics. 11(2):522-39 . Application: IF. Wu M et al. (2020) "The Blood Component Iron Causes Neuronal Apoptosis Following Intracerebral Hemorrhage via the PERK Pathway." Front. Neurol. 11:588548 . Application: IF. Wu D et al. (2020) "Activated WNK3 induced by intracerebral hemorrhage deteriorates brain injury maybe via WNK3/SPAK/NKCC1 pathway." Exp Neuro. 332:113386 . Application: IF. Fang Y et al. (2020) "HIF-1_ Mediates TRAIL-Induced Neuronal Apoptosis via Regulating DcR1 Expression Following Traumatic Brain Injury." Front Cell Neurosci. 14:192 . Application: IF. Lin CT et al. (2020) "3,6 -dithiopomalidomide reduces neural loss, inflammation, behavioral deficits in brain injury and microglial activation." Elife. 9:e54726 . Application: IF. Wu H et al. (2020) "Upregulated Nmnat2 causes neuronal death and increases seizure susceptibility in temporal lobe epilepsy." Brain Res Bull. [Epub ahead of print] . Application: IF. Zahedi K et al. (2020) "Ablation of polyamine catabolic enzymes provokes Purkinje cell damage, neuroinflammation, and severe ataxia." J Neuroinflammation. 17(1):301 . Application: IF. Hu X et al. (2020) "Rh-CSF1 Attenuates Oxidative Stress and Neuronal Apoptosis via the CSF1R/PLCG2/PKA/UCP2 Signaling Pathway in a Rat Model of Neonatal HIE." Oxid Med Cell Longev. 2020:6801587 . Application: IF. Hu H et al. (2020) "Transient receptor potential melastatin 2 contributes to neuroinflammation and negatively regulates cognitive outcomes in a pilocarpine-induced mouse model of epilepsy." Int Immunopharmacol. 87:106824 . Application: IF. Wang S et al. (2020) "Aging exacerbates impairments of cerebral blood flow autoregulation and cognition in diabetic rats." Geroscience. [Epub ahead of print] . Application: IF. Chen PY et al. (2020) "Stearic Acid Methyl Ester Affords Neuroprotection and Improves Functional Outcomes after Cardiac Arrest." Prostag Leukotr Ess. [In Press] . Application: IF. Gamdzyk M et al. (2020) "cGAS/STING Pathway Activation Contributes to Delayed Neurodegeneration in Neonatal Hypoxia-Ischemia Rat Model: Possible Involvement of LINE-1." Mol Neurobiol. 57(6): 2600-19 . Application: IF. Species: Rat Tang H et al. (2020) "Delayed Recanalization After MCAO Ameliorates Ischemic Stroke by Inhibiting Apoptosis via HGF/c-met/STAT3/Bcl-2 Pathway in Rats." Exp Neurol. [Epub ahead of print] . Application: IF. Species: Rat Ocak U et al. (2020) "Inhibition of mast cell tryptase attenuates neuroinflammation via PAR-2/p38/NF?B pathway following asphyxial cardiac arrest in rats." J Neuroinflammation. 17(1):144 . Application: IF. Species: Rat Huang J et al. (2020) "IRE1? inhibition attenuates neuronal pyroptosis via miR-125/NLRP1 pathway in a neonatal hypoxic-ischemic encephalopathy rat model." J Neuroinflammation. 17(1):152 . Application: IF. Species: Rat Fouda MA et al. (2020) "Estrogen-dependent hypersensitivity to diabetes-evoked cardiac autonomic dysregulation: Role of hypothalamic neuroinflammation." Life Sci. 2020 Mar 31:117598. [Epub ahead of print] . Application: IF. Species: Rat Zhou Z et al. (2020) "Sodium butyrate attenuated neuronal apoptosis via GPR41/G??/PI3K/Akt pathway after MCAO in rats." J Cerebr Blood F Met. [Epub ahead of print]. Application: IF. Species: Rat Enam SF et al. (2020) "Engineering Cytokine and Macrophage Enrichment at Sites of Injury." PhD Thesis . Application: IF. Species: Mouse
Specificity:
Degenerating neurons, and neuronal degeneration. There is no specific staining in normal healthy brain. Note: Some researchers under some conditions report blood vessel staining with Fluoro Jade. This may be because Fluoro Jade is an analogue of eosin (which stains blood cells). In general, good perfusion and preparation of the tissue should help prevent blood vessel staining but it may not be possible to eliminate it entirely. In our experience it is generally possible to distinguish neuronal from blood vessels staining by eye.
Storage:
The unopened kit can be stored for up to 6 months at 2-8ºC after the date of receipt. The kit and components should be stored protected from light. Diluted FJC dye solutions are not stable and should be used within 4 hours of making. The other diluted solutions can be reused and stored for up to 48 hours if refrigerated and protected from light. Best results require freshly diluted solutions. We recommend using aseptic techniques when handling the reagents to avoid bacterial growth and contamination.<br><br>The FJC Ready to dilute kit is shipped ambient and stable at room temperature during transport. Refrigerate upon arrival, do not freeze.
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system. The Black Gold II Ready-to-Dilute (RTD) Staining Kit allows you to localise myelin, both individual fibres and tracts, along with the option of co-localising cell bodies via the Toluidine Blue counter stain. Black Gold II labelled myelinated fibres appear nearly black while the Toluidine Blue O labelled cellular Nissl bodies are blue under bright field illumination. Black Gold II can demonstrate and characterise specific myelin changes associated with exposure to diverse neurotoxicants including kainic acid, domoic acid, 3-nitropropionic acid, Fluoro-Gold and isoniazid. Black Gold II can also be combined with other histochemical markers including Nissl stains, retrogradely transported fluorescent tracers and fluorescent markers of neuronal degeneration. The advantages associated with the Black-Gold II include high resolution, high contrast, short histochemical processing time, versatility and consistent reproducibility.
Product Type:
Staining Reagent
Format:
The reagents in the Black Gold kit (10X) are all supplied in a liquid format and are ready-to-dilute.
Species Reactivity:
Mammals
Applications:
IHC-Frozen,IHC-non-Paraffin-embedded
Application Details:
Black Gold II is a high resolution myelin stain with amyloid plaque counter stain. Its use is tailored to studies using formalin or paraformaldehyde fixed, non-paraffin embedded, non-solvent processed brain tissue. It can be used with both thick and thin sections. For thick sections, gelatin coated slides or slides specially designed to bind tissues sections should be use to avoid section loss. Free-floating sections can be used as well but sections are easier to handle and transfer when mounted on slides. A suggested method for thick sections is provided as a guide: Either frozen or vibratome sections are cut at a thickness of 20-50 ?m and collected in 0.1 M neutral phosphate buffer. The sections are then typically mounted on 1% gel-coated slides and then air dried on a slide warmer (at 50°C) for at least an hour until throughly dried and adhered to the slide. The sections can be stained loose, although the sections are easier to handle when mounted on slides. The mounted sections were rehydrated in distilled water for 2 minutes before being processed in the staining solutions.
Alternative Names:
BlackGold, Black and Gold
Biosensis Brand:
Biosensis® RTD
Detection Method:
Colorimetric
Shelf Life:
Unopened kit 6 months at 2-8ºC protected from light. See Storage instructions for working solutions recommendations.
Use:
For research use only.
Kit Components:
Black-Gold II (Dilute 1:10 prior to use) - 10 mL Sodium Thiosulfate, fixative (Dilute 1:10 prior to use) - 10 mL Toluidine Blue O (Dilute 1:10 prior to use) - 10 mL Acetic Acid (Dilute 1:10 prior to use) - 10 mL
Product references:
Lee J et al. (2022) PRMT1 is required for the generation of MHC-associated microglia and remyelination in the central nervous system. Life Sci Alliance. [Epub ahead of print] Germundson DL & Nagamoto-Combs K. (2022) Potential Role of Intracranial Mast Cells in Neuroinflammation and Neuropathology Associated with Food Allergy. Cells. 11(4):738. Kihara Y et al. (2021) Ponesimod inhibits astrocyte-mediated neuroinflammation and protects against cingulum demyelination via S1P1-selective modulation. FASEB J. 36(2):e22132. Toomey LM et al. (2021) Cuprizone feed formulation influences the extent of demyelinating disease pathology. Sci Rep. 11(1):22594. Del Fiacco M et al. (2018) TRPV1-Like Immunoreactivity in the Human Locus K, a Distinct Subregion of the Cuneate Nucleus. Cells. 2018 Jul 8;7(7). pii: E72. Ying YL et al. (2014) Adult neural precursor cells from the subventricular zone contribute significantly to oligodendrocyte regeneration and remyelination. J Neurosci. 2014 Oct 15;34(42):14128-46
Specificity:
Black-Gold II is a novel haloaurophosphate complex which localises myelin within the central nervous system.
Storage:
The kit can be transported at room temperature. Once received, the kit canbe stored for up to 12 months at 2-8°C protected from light. Diluted solutionscan be stored up to one month at 2-8°C protected from light.
Normal sheep serum from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep serum is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
Mixed
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep whole serum at -20°C to -80°C protected from moisture. After reconstitution, divide whole serum nto useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Normal sheep IgG from non-immunized animal, Sheep Polyclonal Antibody
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4, without preservatives.
Host Animal:
Sheep
Species Reactivity:
Non-Reactive (Negative Control)
Immunogen:
None. Sheep IgG is obtained from non-immunized animals.
Applications:
Negative Control
Antibody Isotype:
IgG
Application Details:
Use as negative control for IgG-purified sheep primary antibodies and at matching concentration.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Uncharacterized serum control
Storage:
Store lyophilized sheep IgG at -20°C to -80°C protected from moisture. After reconstitution divide IgG into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Sheep anti-Catenin beta Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-SNQLAWFDTDL) corresponding to the amino acid region 771-781 of human Catenin beta coupled to carrier protein KLH.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunoprecipitation. A concentration of 1.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. A concentration of 5 µg/500 µg of lysate is recommended for immunoprecipitation. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. This antibody was also validated for immunoprecipitation in rat liver lysate (data not shown). Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Catenin beta is an adherens junction protein and has a role in the regulation of cell adhesion and in signal transduction through the Wnt pathway. At least 2 isoforms are produced by alternative splicing.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from 10 mM sodium HEPES (pH 7.5), 150 mM NaCl, and 0.05 % sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (C-QSYLDSGIHSGATTTAPSL) corresponding to the amino acid region 28-46 of human Catenin beta coupled to carrier protein KLH. This antibody was designed to detect the active form of Catenin beta . The antibody exhibits a strong preference for dephosphorylated beta catenin protein by western blot but the antibody may show cross reactivity with phosphorylated catenin beta under certain conditions.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry. A concentration of 2.0 µg/mL is recommended for WB. Human Catenin beta (isoform 1) has a predicted length of 781 residues and MW of 86 kDa. It has been observed as a 92 kDa band in SDS-reducing gels. A concentration of 4.0 µg/mL is recommended for Immunocytochemistry. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
The specificity of this antibody has been confirmed by WB against the antigen. Human; mouse; rat;
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Nerve growth factor (NGF) is synthesized as a precursor (proNGF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proNGF is synthesized in target tissues and glia, transported retrogradely and may be released. This antibody is raised in sheep to detect the prodomain of NGF not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human nerve growth factor
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Immunofluorescence, ELISA, Western Blot, biological neutralization of proNGF. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
pro-brain nerve growth factor; proNGF; NGF;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Sugimoto J et al. (2021). Fabry disease-associated globotriaosylceramide induces mechanical allodynia via activation of signaling through proNGF p75NTR but not mature NGF TrkA. Eur. J. Pharmacol. 895. Application: Neutralising ( in-vivo ). Ryu JC et al. (2018). Role of proNGF/p75 signaling in bladder dysfunction after spinal cord injury. J Clin Invest. [Epub ahead of print]. Application: Western Blotting.
Specificity:
The specificity of this antibody has been confirmed by WB. It does NOT crossreact with proBDNF, proNT-3 or mature NGF. Confirmed to react with purified human proNGF and crossreact with mouse and rat proNGF
Storage:
Maintain lyophilized antibody at 2-8°C for up to 12 months after date of receipt. After reconstitution keep undiluted aliquots at -20°C for up to 6 months for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Brain derived neurotrophic factor (BDNF) is synthesized as a precursor (proBDNF) which may be released and have physiological functions to cause cell death. It binds neurotrophin receptor p75 and sortilin and may also be important for the development of nervous system. proBDNF is synthesized in neurons and glia (eg., microglia), transported anterogradely and retrogradely and may be released in an activity dependent manner. This antibody is raised in sheep to detect the prodomain of BDNF and not the mature peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
The recombinant prodomain fragment of human brain-derived neurotrophic factor
Applications:
ELISA,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
ELISA, Western Blot, biological neutralization of proBDNF, Immunocytochemistry/Immunofluorescence. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Proform brain derived neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed to react with purified human proBDNF, crossreact with mouse and rat proBDNF Cross reactivity with other species than human, mouse and rat has not yet been tested
Storage:
After reconstitution keep aliquots at -20ºC for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen, IHC-Paraffin-embedded.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (PQEGILEDMPVDPC) of human alpha synuclein protein (aa: 108-120) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,IHC-Paraffin-embedded
Antibody Isotype:
IgG
Application Details:
IHC. Recommended to be used at a concentration of 1 µg/mL for immunohistochemistry (Paraffin sections). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunihistochemical analysis of human and rat brain indicates a high level of specificity for this antiserum. Specificity was also confirmed by western blot. This antiserum is known to react with human and rat alpha synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects neurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) of human beta synuclein protein (aa: 108-125) conjugated to diptheria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A working concentration of 1 µg/mL is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is known to react with beta synuclein of human, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) of human alpha synuclein protein (aa: 116-131) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
IgG
Application Details:
Immunohistochemistry (IHC): 1-4 µg/mL (paraffin sections)<br>Western Blotting (WB): 0.5 - 2.0 µg/mL. Fixing of proteins on membrane with 0.4% formaldehyde (30 min at room temperature) recommended, see Lee & Kamitani, 2011.<br>Flow Cytometry: 2 µg antibody per ~10^6 cells, methanol-fixed.<br>Immunocytochemistry (ICC): 1-4 µg/mL, 4% formaldehyde-fixed cells.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Kuo Y.M. et al. (2010) Extensive enteric nervous system abnormalities in mice transgenic for artificial chromosomes containing Parkinson disease-associated alpha-synuclein gene mutations precede central nervous system changes. Hum Mol Genet. May 1;19(9):1633-50 Pelkonen A. et al. (2010) Stimulated dopamine overflow and alpha-synuclein expression in the nucleus accumbens core distinguish rats bred for differential ethanol preference. J Neurochem. 2010 Aug;114(4):1168-76. Alves et al. (2008) Striatal and nigral pathology in a lentiviral rat model of Machado-Joseph disease Hum Mol Genet. 2008 Jul 15;17(14):2071-83.
Specificity:
This antiserum specifically detects alpha synuclein. This antibody is known to react with alpha synuclein of human, mouse, rat and other rodents.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against phosphate buffered saline (PBS).
FUNCTION: Involved in redox regulation of the cell. Can reduce hydrogen peroxide and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. May interact with HTR2A. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 500 to 1: 2000 is recommended. A dilution of 1: 1000 to 1: 2000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Glutathione peroxidase 1 has a role in detoxification of hydrogen peroxide and is one of the most important antioxidant enzymes in humans. It exists as a homotetramer which localises to the cytoplasm. It belongs to the glutathione peroxidase family. Glutathione peroxidase 1 is one of few proteins in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. This protein has a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine repeats. The allele with five alanine repeats is significantly associated with breast cancer risk. Two alternatively spliced isoforms have been identified.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (RRYSRRFQTIDIEPDIEALL) corresponding to the amino acids 175-194 of human lutathione peroxidase 1 ( GPx-1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 2000 to 1: 20000 depending on tissue and detection method. For western blotting a dilution range of 1: 10000 to 1: 100000 is recommended. For ELISA, a dilution of 1: 2000 to 1: 20000 is recommended. This antiserum has extremely high titre, it stains human and rat brain microglia intensely and to some extent also stains neurons. Other tissues have not yet been tested. On Western blotting under reducing conditions recognises a 22kD protein in human brain tissue and Sigma glutathione peroxidase (G-4013) isolated from human erythrocytes. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 1 (GPx-1) protein. Human and rat, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Sheep anti-C-reactive protein Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
C-reactive protein has several roles associated with host defence such as; promoting agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells. COFACTOR: Binds 2 calcium ions per subunit. C-reactive protein exists as a homopentamer. Pentaxin (or Pentraxin) have a discoid arrangement of 5 non-covalently bound subunits. There are 2 alternatively spliced isoforms. C-reactive protein is found in plasma and its concentration increases greatly during acute phase response to tissue injury, infection or other inflammatory stimuli. It is induced by IL-1 and IL-6.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized with 0.01% Thimerosal
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
Human recombinant C-Reactive protein
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Extremely high titre antibody. For western blot a dilution of 1: 10,000 to 1: 100000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CRP; PTX1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
It has been shown to be specific for C-reactive protein by WB. Human, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent.
LRRK2 is a member of the leucine-rich repeat kinase family. It role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (LKRKRKILSSDDSLRSS; aa 946-962) as part of human LRRK2 protein conjugated to the Blue Carrier Protein has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution range of 1:500-1:10000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Sheep anti-Gamma-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Gamma synuclein belongs to the synuclein family which are believed to be involve in the pathogenesis of neurodegenerative diseases. High levels of gamma synuclein have been identified in andvanced breast carcinomas suggesting a correlation between gamma synuclein overexpression and breast tumor development. Gama synuclein plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway. SUBUNIT: May be a centrosome-associated protein. SUBCELLULAR LOCATION: Cytoplasm; perinuclear region. Centrosome. Spindle. Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. TISSUE SPECIFICITY: Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. PTM: Phosphorylated. Phosphorylation by GRK5 appears to occur on residues distinct from the residue phosphorylated by other kinases. DISEASE: Brain iron accumulation type 1 (NBIA1, also called Hallervorden-Spatz syndrome), a rare neuroaxonal dystrophy, is histologically characterized by axonal spheroids, iron deposition, Lewy body (LB)-like intraneuronal inclusions, glial inclusions and neurofibrillary tangles. SNCG is found in spheroids but not in inclusions.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (EKEEVAEEAQSGGD) as part of human gamma synuclein protein (114-127) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 2-5 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Persyn; Breast cancer-specific gene 1 protein; Synoretin; SR; SNCG
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Immunohistochemical/western blot anlysis indicate a high level of specificity for this antiserum for gamma synuclein. This antiserum is known to react with human and rat gamma synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
SUMO-1 binds to a wide range of target proteins as part of a post-translational modification system. Unlike ubiquitin, it does not seem to target protein for degradation, but is involved in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis, apoptosis, protein stability and signal transduction. SUBUNIT: Covalently attached to a number of proteins such as PmL, RANGAP1, HIPK2, SP100, p53, p73alpha, MDM2, JUN and DNMT3B. Also interacts with HIF1A, HIPK2, HIPK3, CHD3, PIAS1, EXOSC9, TDG, RAD51 and RAD52. SUBCELLULAR LOCATION: Nucleus; nuclear membrane. Nucleus; nucleoplasm; nuclear speckle. Cytoplasm. SIMILARITY: Belongs to the ubiquitin family. SMT3 subfamily. SIMILARITY: Contains 1 ubiquitin-like domain. PTM: Cleavage of the last four amino acids of the carboxy-terminus of the precursor form by SENP1 or SENP2 is necessary for function. Several pseudogenes have been reported as well as a number of alternatively spliced isoforms.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKPSTEDLGDKKEGEY) as part of human SUMO-1 peptide (aa: 6-21) conjugated to diphtheria toxoid has been used as the immunogen. This antigen is homologous with SUMO-1 of rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. A dilution of 1:2000 to 1:4000 is recommended for immunohistochemistry and 1:4000 to 1:8000 for western blot. Cell lysate from Hela and NIH-3T3 cell lysates may be used as a positive control, and for IHC, lung carcinoma may be used. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Small ubiquitin-related modifier 1; Ubiquitin-like protein SMT3C; SMT3 homolog 3; Ubiquitin-homology domain protein PIC1; Ubiquitin-like protein UBL1; GAP-modifying protein 1; GMP1; Sentrin; SUMO1; SMT3C; SMT3H3; UBL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognises human SUMO-1 and not ubiquitin. This antiserum is known to cross react with rat and human SUMO-1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-40 (Cx40) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
FUNCTION: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. TISSUE SPECIFICITY: Highly expressed in lung. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Rat
Immunogen:
A synthetic peptide consisting of amino acids 254 to 270 of the C-terminus of rat Cx40 (Cx40/254) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<br><b>Immunohistochemistry</b>: Antibody detects Cxn 40 in rat tissues and arterial endothelial cells. The authors report that the density of Cx40 plaques was significantly greater in the caudal artery (CA) than in the thoracic aorta (ThA), whereas no such difference was seen for Cx37 and Cx43. Expression of Cx40 was absent from the media of both thoracic and caudal artery tissues (see Rummery, NM et al 2002 for more staining specifics). <br><b>Published Method</b>: Unfixed 10 µm thick sections cryosections or lightly fixed (2% paraformaldehyde in 0.1 mol/L sodium phosphate buffer) whole mount sections have been tested, see Rummery, NM et al 2002). Pretreatments include pre-incubation for 30 minutes in a blocking solution of 2% bovine serum albumin (BSA), 0.2% Triton-X in PBS, followed by primary antibody incubation. Antibody was used at 1:100 to 1:250 for 1 hour in the original work but Biosensis recommends optimizing the conditions for the best results. Original detection was via Cy3- conjugated anti-goat immunoglobulins (Jackson Immunoresearch Laboratories Inc, PA, 1:100) in 0.01% Triton-X in PBS, but other secondary conditions should work as well once optimized. In the original work the specificity of each antibody was tested by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised. (Adapted from Rummery, NM et al 2002).<br><b>Western Blot</b>: <U>Antibody is not recommended for western blots by Biosensis</u>, however, it does react in westerns with Cxn 40 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx40/254 antibody specifically recognized a band of 40 kDa from lung, caudal artery (CA), and thoracic aorta (ThA) but not liver (online Figure VIIA, +/- peptide). In the lung, however, a band at 45 kDa also appeared to be reduced with Cxn 40 peptide addition.<br><b>Published Method</b>: Brain, heart, liver, lung, thoracic aorta and caudal arteries were removed from 5-6 week old Wistar rats and snap frozen in liquid nitrogen Tissues were ground under liquid nitrogen in a mortar and pestle and resuspended in 1mL of lysis buffer (1 mM NaHCO3 pH 7.05, 10 mM EDTA, 10 mM Iodoacetamide, 10 mM tetra-sodium pyrophosphate, 1 mM PMSF and 1 µg/mL each of antipain, aprotinin, pepstatin-A, chymostatin and leupeptin). Tissues were further disrupted by grinding in a polytron blender. Unbroken cells and large debris were removed by centrifugation at 1000 g for 5 minutes at 4oC, the supernatant was then removed and centrifuged at 3000 g for 5 minutes. The pellet was discarded, and the supernatant centrifuged at 20000 g for 15 minutes at 4°C. The supernatant was discarded, and the membrane-enriched pellet was resuspended in lysis buffer. Protein concentration was measured using the Bio-Rad protein assay kit. Membrane-bound connexins were subsequently solubilized by incubation in 2x SDS sample buffer (5% SDS, 125 mM Tris-Cl (pH 6.8), 20% glycerol, 2 mM _- mercaptoethanol, 0.1% (w/v) bromophenol blue) for 60 minutes at 37°C. Aliquots containing 5 µg of protein were separated by SDS-PAGE on 12% polyacrylamide gels and blotted onto PVDF membranes. Blots were probed with sheep antibodies against Cx40 (1:1000, Cx40/254) and detected via ECL using anti-Goat poly HRP secondary antibodies 1:4000, 1 hr. (<I>adapted from Rummery, NM et al 2002</I>).Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Gap junction alpha-5 protein; Cx40; Gja5; Cxn-40
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx40/254 in Rummery, NM et al 2002.
Specificity:
It is reported that the Cx40/254 antibody did not cross react with rat Cx43 but may with Cx45 in Western blots only (Rummery, NM et al 2002).
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Connexin-45 (Cx45) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Connexin-45 is a component of gap junctions, which are composed of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low molecular weight diffuse from one cell to a neighboring cell. SUBUNIT: A connexon is composed of a hexamer of connexins. SUBCELLULAR LOCATION: Membrane; multi-pass membrane protein. SIMILARITY: Belongs to the connexin family. Alpha-type (group II) subfamily. Alternatively spliced isoforms have been described.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human
Immunogen:
A synthetic peptide (QAYSHQN NPHGPRE) as part of human Connexin-45 protein (aa: 354-367) conjugated to diphtheria toxoid has been used as the immunogen.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
<b>Immunohistochemistry:</b> Antibody detects sparse Cxn45-IR in caudal artery and heart tissue (see Rummery, NM et al 2002 for more staining specifics). Antibody was used at 1:100 to 1:250, but Biosensis recommends optimal dilutions/concentrations should be determined by the end user. In the original work the specificity of the antibody was shown by incubation either without primary antibody or with primary antibody that had previously been pre-incubated for 1 hour at room temperature with 10-fold excess by weight of the peptide against which the antibody was raised.<br><br><b>Western Blot:</b> Antibody is not recommended for western blotting by Biosensis, however, it does react in westerns with Cxn 45 specific material. The authors report that the antibody develops numerous bands in westerns blots, only some of which are removed upon peptide treatment (see Rummery, NM et al 2002). The Cx45/354 antibody revealed the presence of a specific 45-kDa band in all tissues tested, although it was very weak in the arteries. A higher molecular weight band, which was blocked by peptide, was also seen in the brain (see Rummery, NM et al 2002, online Figure VIIB, -/+ peptide).
Alternative Names:
Gap junction gamma-1 protein; Gap junction alpha-7 protein; Cx45; GJC1; GJA7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Original Reference Rummery NM, Hickey H, McGurk G, Hill CE. (2002) "Connexin37 is the major connexin expressed in the media of caudal artery. Arterioscler Thromb Vasc Biol. 22(9):1427-32. PMID: 12231561 This antibody is referred to as Cx45/354 in Rummery, NM et al 2002.
Specificity:
Western blotting of cell membranes of COS cells transiently transfected with cDNA encoding Connexin-45 shows a singular band of molecular weight 47 kDa which is abolished by preincubation with the immunising peptide. No such band is detected in western blots of membranes from non-transfected cells or cells transfected with cDNA encoding Connexin-37 or Connexin-40. This antiserum reacts to human Connexin-45.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Seems to promotes the survival of visceral and proprioceptive sensory neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA (1 site), Western Blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a concentration of 2-10 µg/mL for immunohistochemistry, ELISA and Western blot and inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Application: Rat, Block/Inhibit. Beros J (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis Application: Rat, Block/Inhibit. Feron F et al. (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: Rat, IHC.
Specificity:
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by dot blot. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Target-derived survival factor for peripheral sensory sympathetic neurons. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. Expressed in embryonic and adult tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Primate,Rat
Immunogen:
Recombinant human NT4
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA (1 site), Western Blot, dot blot, inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:500 to 1:2000 for immunohistochemistry, ELISA and Western blot. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Note that the concentration of NT4 is generally low in most tissues nevertheless, neonatal testes of rat can be used as a good positive control. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Less than 1% cross-reactivity against NGF, recombinant human BDNF and 5% to NT3 has been shown by 1-site ELISA. Known to react with NT4 from rat and human, mouse and monkey.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. This antiserum will neutralise NT3 but not other neurotrophins. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
Recombinant human NT3
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, dot blot, inhibition of biological activity. A dilution of 1:200 to 1:2000 is recommended for IHC, ELISA and western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% to mouse NGF, recombinant human BDNF and 5% to NT4/5 has been shown by 1-site ELISA. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human, mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A dilution of 1:500 to 1:2000 is recommended for IHC, western blot. For inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Feron F et al (2008) Neurotrophin expression in the adult olfactory epithelium. Brain Res. 1196:13-21 Application: IHC ; Species: Rat
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A concentration of 1-3 µg/mL is recommended for IHC, western blot and immunoblot, ELISA, inhibition of biological activity in vitro. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. It stimulates division and differentiation of sympathetic and embryonic sensory neurons. SUBUNIT: Homodimer, associated by noncovalent forces. SUBCELLULAR LOCATION: Secreted protein. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Avian,Human,Mouse,Rat
Immunogen:
Native mouse beta NGF purified from submaxillary salivary gland (95% purity by PAGE)
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, 1-site ELISA, WB, immunoblot, inhibition of biological activity. A dilution of 1:1000-1:5000 is recommended for IHC, western blot and immunoblot; 1:15000 for ELISA; for inhibition of biological activity: 1:10-50 for in vitro, 5-10 µL/g body weight for in vivo. This antiserum completely inhibits neuronal survival and the outgrowth actions of murine NGF in chicken DRG in vitro. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-nerve growth factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
A cross reactivity of less than 1% to recombinant human BDNF, NT3, NT4/5 by ELISA has been shown. This antiserum is known to cross react with mouse, rat, human and avian NGF but not bovine NGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IH on PFA fixed, frozen tissues. Not yet tested on formalin fixed, paraffin embedded tissue but expected to react. Affinity purified antibody is extremely powerful. A concentration of 1 -5 µg/mL is recommended most uses with short (1-8 hour) incubations. If using enhanced brightfield or amplified detection methods dilutions and long primary antibody incubations dilutions will need to be increased substantially to inhibit background staining. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.<br><br>Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting.
Alternative Names:
Proto-oncogene protein cFOS; c-FOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for cFOS confirmed by immunohostochemistry. This antiserum is known to react with rat, rabbit and hamster cFOS.
Storage:
Store lyophilized product at 2-8°C. After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Detects human alpha-, beta-, and gamma synuclein proteins. A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins conjugated to diphteria toxoid has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A concentration of 3 µg/mL is recommended for immunohistochemistry (frozen & paraffin embedded sections) and 1 µg/mL for western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Overlap specific immunohistochemical staining of alpha-, beta- and gamma synucleins This antiserum recognises human and rat alpha-, beta- and gamma synucleins.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified and dialysed against PBS. Contains 0.02% sodium azide.
Sheep anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Beta-synuclein is a non-amyloid component of senile plaques found in Alzheimer disease. It could act as a regulator of SNCA aggregation. It protects nerurons from staurosporine and 6 hydroxy dopamine -stimulated capspase activation in a p53-dependent manner. It localises to the cytoplasm and it is predominantly expressed in the brain where it is most concentrated in presynaptic nerve terminals. This protein is phosphorylated. This protein is also associated with the disease Brain iron accumulation type 1 (NBIA1).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (IEPLMEPEGSYEDPPQE) as part of human beta synuclein protein (aa: 108-125) conjugated to diphteria toxid has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:3000 to 1:8000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
SNCB
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Known to be specific for beta synuclein. This antiserum is know to react with human, rat and other rodent beta synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Ancient ubiquitous protein 1 (AUP1) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
AUP1 contains a domain with homology to the ancient conserved region of the archain 1 gene and a domain thay may be involved in binding ubiquitin-conjugating enzymes. The unprocessed precusor is of 476 amino acids in length and has an estimated molecular weight of 53 kDa. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing.TISSUE SPECIFICITY: Ubiquitous. SIMILARITY: Belongs to the AUP1 family. SIMILARITY: Contains 1 CUE domain.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Bovine,Human,Rat,Sheep
Immunogen:
A synthetic peptide (HVFLVSCALPDSV) corresponding to the amino acids 48-60 of human ancient ubiquitous protein 1 conjugated to Blue carrier protein has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from bovine, mouse and rat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. Use at a dilution of 1:500 to 1:6000. This antiserum works superbly in both paraffin embedded and frozen tissues. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
AUP1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum is specific for ancient ubiquitous protein 1. This antibody is known to react with bovine, sheep, human and rat ancient ubiquitous protein 1. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Hamster,Human,Rabbit,Rat
Immunogen:
A synthetic peptide (MFSGFNADYEASSSRC; aa 2-17) conjugated to diphtheria toxoid has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from cFos protein human, rat, mouse, hamster and cat.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC: Use at an amount of 10 µg/mL with an incubation time of 1-3 days at 4ºC. This antiserum works in paraffin and 4% PFA fixed frozen sections. Penetration is the key to success. Over-fixed tissue is problematic. Not recommended for western blotting applications. Mouse monoclonal antibody M-1752-100 or rabbit polyclonal antibody R-1751-50 are excellent alternatives for western blotting. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
c-Fos; Proto-oncogene protein cFOS; cellular oncogene fos; G0/G1 switch regulatory protein 7; FOS; G0S7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum shows a high level of specificity for c-FOS confirmed by immunohistochemistry. This antiserum is known to react with rat and rabbit and hamster cFOS.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
CNTF is a survival promoting factor for different types of neurons in vitro and in vivo. The essential structural features for the biological function of human CNTF were investigated by Thier, M. et al. They showed that deletion of 14 N-terminal and 18 C-terminal amino acids significantly increased bioactivity compared to wild-type CNTF. FUNCTION: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. SUBUNIT: Homodimer. SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Nervous system. PHARMACEUTICAL: CNTF is being tested under the name Axokine by Regeneron Pharmaceuticals for treatment of human motor neuron diseases, such as amyotrophic lateral sclerosis (ALS). As it induces substantial weight loss, preferentially of fat as opposed to lean body mass, it is being used for obesity treatment. SIMILARITY: Belongs to the CNTF family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human CNTF
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. A dilution of 1:500 to 4000 is recommended for these applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Ciliary neurotrophic factor
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody specifically detects CNTF shown by western blot. This antiserum to known to react with rat, mouse and human CNTF protein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Sheep anti-Alpha-synuclein Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Alpha synuclein is an abundant 140 amino acid neuronal protein, expressed primarily at presynaptic terminals in the central nervous system. Alpha synuclein has been associated with several neurodegenerative diseases. A point mutation in the gene coding for the alpha-synuclein protein was the first discovery linking this protein to a rare familial form of Parkinson's disease (PD). Subsequently, other mutations in the alpha-synuclein gene have been identified in familial PD. The aggregated proteinaceous inclusions called Lewy bodies found in PD and cortical Lewy body dementia (LBD) were discovered to be predominantly alpha-synuclein. Aberrant aggregation of alpha-synuclein has been detected in an increasing number of neurodegenerative diseases, collectively known as synucleopathies. Alpha-synuclein exists physiologically in both soluble and membrane-bound states, in unstructured and alpha-helical conformations, respectively. The physiological function of alpha-synuclein appears to require its translocation between these subcellular compartments and interconversion between the 2 conformations. Abnormal processing of alpha-synuclein is predicted to lead to pathological changes in its binding properties and function.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (CMPVDPDNEAYEMPSEE) as part of human alpha synuclein (aa: 116-131) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC with 1:1000 to 1:2000 dilution. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Non-A beta component of AD amyloid; Non-A4 component of amyloid precursor; NACP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Wu W et al. (2022) "Intermediate-length CGG repeat expansion in NOTCH2NLC is associated with pathologically confirmed Alzheimers disease" Neurobiol. Aging 80(1):447-458; Application: IHC Species: Human Cong C et al. (2021) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." J Alzheimers Dis. 80(1):447-458; Application: IHC Species: Human Zhang W et al. (2020) "Contribution of Alzheimer's Disease Neuropathologic Change to the Cognitive Dysfunction in Human Brains with Lewy Body-Related Pathology." Neurobiol. Aging [In press]; Application: IHC Species: Human
Specificity:
Immunohistochemistry shows a high specificity for alpha-synuclein. This antibody is known to react with human, rat and mouse alpha-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Sheep anti-Myelin basic protein (MBP) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Myelin is a membrane characteristic of the nervous tissue and functions as an insulator to increase the velocity of the stimuli being transmitted between a nerve cell body and its target. Myelin isolated from human and bovine nervous tissue is composed of approximately 80% lipid and 20% protein, and 30% of the protein fraction constitutes myelin basic protein (MBP). MBP is an 'intrinsically unstructured' protein with a high proportion (approximately 75%) of random coil, but postulated to have core elements of beta-sheet and alpha-helix. MBP is a major protein in CNS myelin and is expressed specifically in the nervous system. A detailed immunochemical examination of monoclonal and polyclonal antibody responses to MBP and its peptides has revealed the existence of as many as 27 antigenic determinants, many of them conformational. Topological mapping of the potential antigenic determinants onto a model of MBP secondary structure places these determinants within 11 separate regions of the molecule, including those portions that have been found to be encephalitogenic. The message for myelin basic protein is selectively translocated to the ends of the cell processes. Immunization with myelin-associated antigens including MBP significantly promotes recovery after spinal cord contusion injury in the rat model. FUNCTION: Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity). SUBUNIT: Homodimer (By similarity). SUBCELLULAR LOCATION: Myelin membrane; peripheral membrane protein; cytoplasmic side. Cytoplasmic side of myelin. TISSUE SPECIFICITY: Found in both the central and the peripheral nervous system. PTM: At least 5 charge isomers; C1 (the most cationic, least modified, and most abundant form), C2, C3, C4 and C5 (the least cationic form); are produced as a result of optional posttranslational modifications such as phosphorylation of serine or threonine residues, deamidation of glutamine or asparagine residues, citrullination and methylation of arginine residues. C1 and C2 are unphosphorylated, C3 and C4 are monophosphorylated and C5 is phosphorylated at two positions. SIMILARITY: Belongs to the myelin basic protein family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Guinea Pig,Human,Rat
Immunogen:
A synthetic peptide (YG SLPQKSQRSQ DENPVV, aa: 68-86) as part of guinea pig MBP protein conjugated to KLH
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC. A dilution of 1:1000 to 1:4000 is recommended. Immunostaining for MBP of abnormal appearing oligodendrocytic process and cell bodies in demyelinating areas. This antibody recognises only areas of myelin degeneration when tested in injured spinal cord and lesioned sciatic nerves. It also stains discrete white matter in the brain of multiple system atrophy. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Myelin Basic Protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antiserum recognizes MBP in demyelinated nerve tissues. Immunohistochemical analysis of lesioned rat spinal cord indictaes a high level of specificity for this antiserum. This antiserum reacts with human and rat MBP.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
WB. Recommended to be used at a dilution of 1:1000 to 1:3000 for Western blot. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
GDNF is a glycosylated, disulfide-bonded homodimer molecule. It was first discovered as a potent survival factor for midbrain dopaminergic neurons and was then shown to rescue these neurons in animal models of Parkinson's disease. GDNF is about 100 times more efficient survival factor for spinal motor neurons than the neurotrophins. FUNCTION: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. ALTERNATIVE PRODUCTS: 2 named isoforms produced by alternative splicing. DISEASE: Defects in GDNF may be a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, defects in GDNF may be involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. DISEASE: Defects in GDNF are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human GDNF
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. A dilution of 1 µg/mL is recommended for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
No cross reactivity with NTN has been observed in western blot analysis. This antibody is known to react with human, mouse and rat GDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
Mixed
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo. Recommended to be used at a dilution of 1:200-2000 for immunohistochemistry on Zamboni's fixed frozen tissue; not recommended for formalin fixed paraffin embedded tissues. 1:10 to 1:50 for inhibition of biological activity in vitro. Use neat for in vivo studies at 5-10 µL/g body weight. Whole serum format will caused immune responses, purified format is preferred for most in vivo work. Not recommended for western blots. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. This antiserum recognises BDNF from rat, mouse and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Rat
Immunogen:
Recombinant human BDNF
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, Inhibition of biological activity in vitro/in vivo, ELISA. Recommended to be used at an amount of 1-10 µg/mL for immunohistochemistry on Zamboni's fixed, frozen tissue. Not recommended for paraffin embedded tissues. Primary use is for biological activity in vitro and in vivo. Use neat for in vivo studies at 2-10 µg/mL (ED50). This antibody does not react to BDNF in western blot, thus western blot is not a recommended application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Beros J. et al. (2021) Age Related Response of Neonatal Rat Retinal Ganglion Cells to Reduced TrkB Signaling in vitro and in vivo. Front Cell Dev Biol. 9:671087. Beros J. (2020) Pretreatment of ovaries with collagenase before vitrification keeps the ovarian reserve by maintaining cell-cell adhesion integrity in ovarian follicles. PhD Thesis. Hayashida K., Eisenach JC. (2010) Spinal alpha2-adrenoceptor-mediated analgesia in neuropathic pain reflects brain-derived nerve growth factor and changes in spinal cholinergic neuronal function. Anesthesiology. 2010 Aug;113(2):406-12. Geremia NM. et al. (2010) Endogenous BDNF regulates induction of intrinsic neuronal growth programs in injured sensory neurons. Exp Neurol. 2010 May;223(1):128-42.
Specificity:
A cross reactivity of less than 1% against mouse NGF, recombinant human NT3 or NT4/5 has been shown by one site ELISA. Known to react with BDNF from rat and human.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Neurturin (NTN) is a member of the GDNF family of neurotrophic factors. This protein is a potent survival factor for several populations of central and peripheral neurons in mature and developing rodents. FUNCTION: Supports the survival of sympathetic neurons in culture. May regulate the development and maintenance of the CNS. Might control the size of non-neuronal cell population such as haemopoietic cells. SUBUNIT: Homodimer; disulfide-linked. SUBCELLULAR LOCATION: Secreted protein. DISEASE: Defects in NRTN are a cause of Hirschsprung disease (HSCR). In association with mutations of RET gene, and possibly with other loci, defects in NRTN are involved in Hirschsprung disease. This genetic disorder of neural crest development is characterized by the absence of intramural ganglion cells in the hindgut, often resulting in intestinal obstruction. SIMILARITY: Belongs to the TGF-beta family. GDNF subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human Neurturin (rh NTN)
Applications:
ELISA,IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, immunoblot, 1-site ELISA. Recommended to be used at a dilution of 1:2000-3000 for immunohistochemistry and Western blot, 1: 2000 to 1:4000 for ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurturin; NRTN;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Dot blot shows no cross reactivity to GDNF. This antibody is known to react with human, mouse and rat. Not yet tested against other species.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Fibroblast growth factors (FGFs), a heparin binding growth factor, exhibit widespread mitogenic and neurotrophic activities in a variety of different cells including mesenchymal, neuroectodermal and endothelial cells. aFGF (FGF-1) and bFGF (FGF-2) are present in relatively high levels in CNS. aFGF is expressed by a subset of neuronal populations, while bFGF is expressed by astrocytes, both lack signal peptides. Human bFGF is a 17.2 kDa protein containing 155 amino acid residues. FUNCTION: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors. SUBUNIT: Monomer. Interacts with CSPG4 and FGFBP1. Found in a complex with FGFBP1, FGF1 and FGF2. MISCELLANEOUS: This protein binds heparin more strongly than does aFGF. SIMILARITY: Belongs to the heparin-binding growth factors family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Sheep
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Recombinant human basic FGF
Applications:
IHC-Frozen,WB
Antibody Isotype:
Mixed
Application Details:
IHC (frozen), WB. Recommended to be used at a dilution of 1: 1000 to 1:2000 for both applications. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Lee HJ et al (2010) Effects of sevoflurane on collagen production and growth factor expression in rats with an excision wound. Acta Anaesthesiol Scand. 2010 Aug;54(7):885-93.
Specificity:
A high level of specificity for bFGF was shown by immunohistochemistry for this antiserum. This antibody is known to react with human, mouse and rat basic FGF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta Amyloid Polyclonal Antibody (Unconjugated), suitable for ELISA.
Background Info:
The beta Amyloid peptide is derived from the cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. Beta amyloid peptides are the major constituents of the plaques and tangles that occur in Alzheimer's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (DAEFRHDSGYEVHH) conjugated to bovine serum albumin (BSA) corresponding to amino acid sequence 1-14 of mature human beta amyloid.
Applications:
ELISA
Antibody Isotype:
Mixed
Application Details:
ELISA. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Human beta amyloid, cross reactivity to APP has not bee tested.
Storage:
At least 12 months after purchase at 2-8°C (lyophilized formulations). After reconstitution, aliquot and store at -20°C for a higher stability and at 2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Fox3 is one of a family of mammalian homologues of Fox-1. The Fox proteins are about 46 kDa in size, and each includes a central highly conserved RRM type RNA recognition motif. Much interest has focused on Fox3 as a result of the recent finding that this protein corresponds to NeuN, a neuronal nuclear antigen. NeuN/Fox-3 has a function in RNA splicing and is expressed heavily and specifically in neuronal nuclei and cytoplasm. Our antibody was raised against the N-terminal 100 amino acids of human Fox3 as expressed in and purified from E. coli. We did not use full length Fox3 as immunogen since the three mammalian Fox homologues, namely Fox1, Fox2 and Fox3, include virtually identical RRM motifs. The N-terminal region of the three molecules are much more variable in the three molecules so antibodies specific for each of the three molecules can therefore be generated.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Peptide corresponding to amino acids 5-24 of human FOX3 coupled to KLH.
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:500 - 1:1,000 is recommended for WB. A dilution of 1:5,000 - 1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Feminizing locus on X; Fox-1; Fox3; NeuN; NeuN antigen; Neuronal nuclei antigen; Fox-1 homolog C; RNA binding protein fox-1 homolog 3
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit Polyclonal Antibody to Neurofilament NF-L C-terminus (Unconjugated), suitable for WB, IF, ICC.
Background Info:
Neurofilaments are the 10nm or intermediate filament proteins found specifically in neurons, and are composed predominantly of three major proteins called NF-L, NF-M and NF-H, though other filament proteins may be included also. The major function of neurofilaments is likely to control the diameter of large axons. NF-L is the neurofilament light or low molecular weight polypeptide and runs on SDS-PAGE gels at 68-70kDa with some variability across species. Antibodies to NF-L are useful for identifying neuronal cells and their processes in cell culture and sectioned material. NF-L antibody can also be useful for the visualization of neurofilament rich accumulations seen in many neurological diseases, such as Lou Gehrigs disease (ALS), giant axon neuropathy, Charcot-Marie Tooth disease and others.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Pig,Rat
Immunogen:
C-terminal synthetic peptide of rat NF-L protein,(GEEEDTKESEEEEKKEESAGEEQAAKKKD) with an N-terminal Cys for coupling to KLH.
Applications:
FC,ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (IHC) and Flow Cytometry (2 ug per 10^6 cells). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:100 - 1:500 is recommended for IC and IH. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofilament light polypeptide; 68 kDa neurofilament protein; Neurofilament triplet L protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Solid
Product references:
Bacioglu M et al. (2016) Neurofilament light chain in blood and CSF as a marker of disease progression in mouse models and in neurodegenerative diseases. Neuron. 27292537 Application: Mouse and Human.
Specificity:
No cross reactivity with other proteins.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Rabbit anti-Pan-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, FC.
Background Info:
A family of homologous proteins known as alpha-, beta-, and gamma-synuclein are abundantly expressed in brain, especially in the presynaptic terminal of neurons. Although the precise function of these proteins remains unknown, alpha-synuclein has been implicated in synaptic plasticity associated with avian song learning as well as in the pathogenesis of Parkinson's disease (PD), dementia with LBs (DLB), some forms of Alzheimer's disease (AD), and multiple system atrophy (MSA).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2-7.6, containing 0.1% trehalose without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (AKEGVVAAAEKTKQGV) as a consensus part of human alpha-, beta-, and gamma synuclein proteins has been used as the immunogen.
Applications:
FC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (0.5-2 ?g/mL). Flow Cytometry (10-20 ?g/mL). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen epitope location:
Amino acids 11-26 of human alpha-synuclein protein.
Immunogen length:
16 amino acids.
Physical State:
Solid.
Specificity:
This antibody recognises human, mouse, rat alpha-, beta- and gamma-synuclein.
Storage:
After reconstitution keep aliquots at -20°C for long-term stability. Working aliquots can be kept at 2-8°C for up to 4 weeks, or longer with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and flow cytometry.
Purification:
Purified by affinity chromatography against the peptide immunogen.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length human recombinant ?-synuclein protein expressed in and purified from E. Coli.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:2,000) and Immunohistochemistry (frozen sections, 1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Beta-synuclein, ?-synuclein
Biosensis Brand:
Biosensis®
Cellular Localisation:
Intracellular, cytosolic.
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Immunogen length:
Full-length recombinant protein.
Physical State:
Solid.
Specificity:
Specific for ?-synuclein, does not cross-react with ?- or ?-synuclein.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Validated by western blotting and immunohistochemical procedures.
Purification:
Affinity-purified from rabbit serum using the immunogen.
Rabbit anti-Microtubule-associated protein Tau (MAPT) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
FUNCTION: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. SUBCELLULAR LOCATION: Cytoplasm; cytosol. Cell membrane. Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components. ALTERNATIVE PRODUCTS: 8 named isoforms produced by alternative splicing. Additional isoforms seem to exist. Isoforms differ from each other by the presence or absence of up to 5 of the 15 exons. One of these optional exons contains the additional tau/MAP repeat. TISSUE SPECIFICITY: Expressed in neurons. Isoform PNS-tau is expressed in the peripheral nervous system while the others are expressed in the central nervous system. DEVELOPMENTAL STAGE: Four-repeat (type II) tau is expressed in an adult-specific manner and is not found in fetal brain, whereas three-repeat (type I) tau is found in both adult and fetal brain. DOMAIN: The tau/MAP repeat binds to tubulin. In Alzheimer disease, the neuronal cytoskeleton in the brain is progressively disrupted and replaced by tangles of paired helical filaments and straight filaments, mainly composed of hyperphosphorylated forms of Microtubule-associated protein Tau. Defects in Microtubule-associated protein Tau are a cause of frontotemporal dementia and parkinsonism linked to chromosome 17, as well as a number of other neurodegenerative diseases.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Pig
Immunogen:
Recombinant human Microtubule-associated protein Tau, purified from E.coli.
Applications:
ELISA,WB
Antibody Isotype:
Mixed
Application Details:
WB and direct ELISA (Human). For WB a dilution of 1:500 is recommended. This antibody has been shown to detect the purified recombinant Tau expressed in E.Coli as well as a number of Tau isoforms in porcine cytosol. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau; MAPT; MTBT1; TAU
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Ballaz S, Morales I, Rodriguez M, Obeso JA. (2013) Ascorbate prevents cell death from prolonged exposure to glutamate in an in vitro model of human dopaminergic neurons. J. Neurosci Res. Aug 30 2013 [E print]
Specificity:
Specificity was demonstrated by western blot. 20ng recombinant Tau is easily detected with smaller fragments likely representing degradation products from the purified protein, which has been expressed in E. Coli. This antiserum is known to react with human and pig Microtubule-associated Tau proteins. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Green fluorescent protein (GFP) Polyclonal Antibody (Unconjugated), suitable for WB, IHC.
Background Info:
The green fluorescent protein (GFP) is a 27 kDa protein isolated originally from the jellyfish Aequoria victoria. It has an endogenous fluorochrome activity with excitation maximum at 395nm and emission maximum at 509 nm, which is similar to that of fluorescein. GFP can be expressed in fluorescent form in essentially any prokaryotic or eukaryotic cell. This GFP rabbit antibody was made against a recombinant GFP construct originating from an Aequoria species which was engineered to improve spectral properties and prevent oligomerization (1). This form of GFP, referred to as AcGFP, is 94% identical to the eGFP developed by Tsien and co-workers. The antibody can be used to verify the expression, size and stability of both AcGFP and eGFP fusion proteins in western blotting experiments and to amplify GFP signals in tissues of transgenic animals.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Species Independent
Immunogen:
Recombinant AcGFP purified from E. coli
Applications:
IHC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (1:2,000 - 1:5,000) and Western Blot (1:1,000 - 1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Aequorea victoria green fluorescent protein
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
GFP, cross reactivity with other mutant forms is expected as immunogen was a whole molecule GFP
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks). Avoid repetitive freeze/thaw cycles.
LRRK2 is a member of the leucine-rich repeat kinase family. Its role is yet unknown but it may play a role in the phoshorylation of proteins central to parkinson diseases. LRRK2 contains an ankryin repeat region, a leucine-rich repeat (LRR) domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a mLK-like domain and a WD40 domain. LRRK2 is present in the cytoplasm but also associates with the mitochondrial outer membrane. Defects in LRRK2 are the cause of Parkinson disease 8 (PARK8). Parkinson disease is characterised by bradykinesia, resting tremor, muscular rigidity and postural instability, as well as by a clinically significant response to treatment with levodopa. The pathology involves the loss of dopaminergic neurons in the substantia nigra and the presence of Lewy bodies (intraneuronal accumulations of aggregated proteins), in surviving neurons in various areas of the brain. PARK8 is an autosomal-dominant late-onset parkinsonism, characterized by onset from 50 to 65 years, with slow progression and relatively benign course.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (CLKRKRKILSSDDSLRSS) corresponding to amino acids 946 - 962 of the human LRRK2 protein conjugated to diptheria toxin was used as the immunogen.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A dilution range of 1:500 to 1:1000 is recommended. Other applications have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specificity was demonstrated by immunohistochemistry. The antibody stains positive tangles in inferior temporal cortex of human brain affected by Alzheimer's disease. This antiserum has been successfully tested in human. Other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
C-terminal peptide of human IBA1 protein coupled to KLH.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:2,000-1:5,000); Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Allograft inflammatory factor 1, AIF-1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ubiquitin Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen, ICC.
Background Info:
Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa which has a central role in regulated protein degradation. It is a protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Several types of polymeric chains can be formed depending on the lysine used for the assembly. Attachment to proteins as a polymer leads to their degradation by the 26S proteosome; a complex, multicatalytic cytosolic and nuclear protease. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatic structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with exact head to tail repeats, the number of repeats of which differ between species and strains. In some species there is a final amino-acid after the last repeat, here in bovine a Cys. Some ubiquitin genes contain a single copy of ubiquitin fused to a ribosomal protein (either L40 or S27a).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.2, 100mM NaCl, 15mM sodium azide.
Ubiquitin isolated from cow erythrocytes and conjugated to chicken gammaglobulins with glutaraldehyde.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
This antibody is recommended for IHC, WB and immunoprecipitation. This antibody can be used for labelling formalin-fixed, paraffin-embedded tissue sections at a dilution range of 1:150 to 1:300. This antibody is also useful for investigating neurodegenerative diseases such as Alzheimer 's disease and Parkinson's disease. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
RPS27A; UBA52; UBB; UBC
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The specificity of this antibody has been determined by indirect ELISA against ubiquitin conjugated to keyhole limpet haemocyanin. The antibody does not react with kehole limpet haemocyanin alone. Specificity has also been demonstrated by WB against endometrial tissue homogenates. Cross reacts with human, baboon and rat ubiquitin. Other species have not been tested. Ubiquitin protein sequence is 100% conserved in all higher mammals and most eukarotes.
Storage:
After reconstitution keep aliquots at -20°C for higher stability or at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Nestin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required for brain and eye development. Promotes the disassembly of phosphorylated vimentin intermediate filaments (IF) during mitosis and may play a role in the trafficking and distribution of IF proteins and other cellular factors to daughter cells during progenitor cell division. Required for survival, renewal and mitogen-stimulated proliferation of neural progenitor cells (By similarity). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Part of recombinant human protein (amino acids 315-630).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human. Other species not tested.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Methyl-CpG- binding protein 2 (MeCP2) Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide (REEPVDSRTPVTERVS, aa: 471-486) of C-terminus of human protein.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000) Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CNPase
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Mouse, Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Laminin-111 Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organisation of cells into tissues during embryonic development by interacting with other extracellular matrix components. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Mouse,Rat
Immunogen:
Laminin-111 isolated from mouse EHS cells
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunohistochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Laminin 1, Laminin _1_1_1.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Mouse,reacts with Mouse and Rat, other species not tested. This antibody recognizes laminin isotypes alpha-1 (440 kDa), beta-1 (220 kDa) and gamma-1 (220 kDa). It also binds laminin binding protein at 120 kDa which always co-expresses with laminin.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Ki-67 Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable). Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human Ki-67 protein (amino acids 1,111-1,490) expressed in and purified from <i>E. coli.</i>
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:2,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
KI-67
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human only. Does not react with Mouse or Rat.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
May participate in RNA metabolism in the myelinating cell, CNP is the third most abundant protein in central nervous system myelin. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:1,000-1:5,000) and Immunocytochemistry (1:1,000-1:2,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Rat, Mouse.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Calretinin is a calcium-binding protein which is abundant in auditory neurons. Ref: uniprot.org
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Bovine,Human,Mouse,Rat
Immunogen:
Full-length recombinant human protein
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Western blotting (1:5,000-1:10,000), Immunohistochemistry (1:5,000-1:10,000) and Immunocytochemistry (1:1,000-1:5,000). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
CR, 29 kDa calbindin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human,reacts with Human, Cow, Rat, Mouse. Antibody is specific for calretinin and does not recognize closely related proteins parvalbumin and calbindin as determined by Western Blotting.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Beta casein protein Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Beta-casein has an important role in determination of the surface properties of the casein micelles. it is cleaved into 3 chains (casoparan, casohypotensin and antioxidant peptide). Casoparan acts as a macrophage activator, increasing the phagocytic activity of macrophages and peroxide release from macrophages. It also acts as a bradykinin-potentiating peptide. Casohypotensin acts as a bradykinin-potentiating peptide and induces hypotension in rats. Acts as a strong competitive inhibitor of endo-oligopeptidase A. Antioxidant peptide has antioxidant activity (ref: uniprot.org.).<br /><br />Bovine milk contains two types of beta-casein protein, A2 or A1. Recent studies have shown that milk containing the A1 beta casein protein can contribute to issues including gastrointestinal discomfort after ingestion. There is some evidence of a link between ingestion of A1 beta casein protein and the development of Type 1 diabetes.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Liquid in PBS, pH 7.4, with 0.02% sodium azide as preservative. Refer to the product label for antibody concentration.
Host Animal:
Rabbit
Species Reactivity:
Bovine
Immunogen:
Bovine beta-casein peptides
Applications:
ELISA,WB
Antibody Isotype:
IgG
Application Details:
ELISA and western blotting (1:5,000 - 1: 20,000). Do not use skim milk for blocking and dilution of assay reagents, BSA is recommended. Biosensis recommends that optimal working dilutions should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Physical State:
Liquid.
Product references:
Indyk HE et al. (2021) The determination of intact ?-casein in milk products by biosensor immunoassay. J. Food Compos. Anal. 101:103946 Application: Immunoassay.
Specificity:
Bovine beta-casein. Detects both A1 and A2 beta-casein isoforms.
Storage:
Spin vial briefly before opening and centrifuge to remove any insoluble material. After opening maintain at -20°C in undiluted aliquots for up to 6 months. For short-term storage, keep aliquot at 2-8°C for up to one week. Avoid repeated freeze-thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. Post translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted),Rat
Immunogen:
A synthetic peptide (C-ELLDEDQKVRPNEE) as a part of human BDNF precursor protein (aa: 69-82) conjugated to KLH has been used as the immunogen.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
IHC, WB. 1-5 µg/mL is recommended for both applications, Flow Cytometry (2?g/10^6 cells). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Le Blanc J et al. (2020) Platelets Selectively Regulate the Release of BDNF, But Not That of Its Precursor Protein, proBDNF. Front Immunol. 11:575607 Application: Human, WB. Macias M et al. (2007) Locomotor exercise alters expression of pro-brain-derived neurotrophic factor, brain-derived neurotrophic factor and its receptor TrkB in the spinal cord of adult rats. Eur J Neurosci. 25(8):2425-44 Application: Rat
Specificity:
Used in western blot, this antiserum detects a 35 kDa band corresponding to the molecular weight of proBDNF. No cross reactivity with other proneurotrophins was detected. This antibody is known to react with human, mouse and rat proBDNF and also expected to recognise other mammalian proBDNF.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
FUNCTION: Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum. SUBUNIT: Heterodimer. Interacts with DSIPI; this interaction inhibits the binding of active AP1 to its target DNA. Interacts with MAFB. SUBCELLULAR LOCATION: Nucleus. INDUCTION: C-fos expression increases upon a variety of stimuli, including growth factors, cytokines, neurotransmitters, polypeptide hormones, stress and cell injury. SIMILARITY: Belongs to the bZIP family. Fos subfamily. SIMILARITY: Contains 1 bZIP domain (Ref: uniprot.org).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Full length, E.coli-derived recombinant human c-FOS protein.
Applications:
ICC,IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC): 1:2,000-1:10,000.<br><br>Immunohistochemistry (IHC): 1:20,000-1:50,000. This antibody has been shown to work on 4% PFA fixed mouse brain sections. Note that non-specific staining has been observed on tissue sections when using this antibody at dilutions of 1:5,000 or lower.<a class="newA" target="_blank" href="https://www.biosensis.com/documents/enhancedinfo/R-1751-50_IHC Method_as_at_March2018.pdf"> Click here </a> for instructions on use of this antibody in IHC on free-floating brain sections.<br><br>Western blotting (WB): 1:1,000-1:2,000. This antibody detects bands between 50-65 kDa, which only appear in stimulated cells. <br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Cellular oncogene fos; G0/G1 switch regulatory protein 7; cFOS
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Lin King JV (2020). Stinging Sensations: Activation Mechanisms of the Wasabi Receptor, TRPA1. PhD Thesis. Application: IHC (IF) . Species: Mouse. Lin King JV et al. (2019). A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain. Cell. [Epub ahead of print]. Application: IHC . Species: Mouse.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
NT3 is a member of the neurotrophin family, that controls survival and differentiation of visceral and proprioceptive sensory neurons. NT3 is closely related to both NGF and BDNF. It may be involved in the maintenance of the adult nervous system, and may affect development of neurons in the embryo when it is expressed in human placenta. NT3-deficient mice generated by gene targeting display sevvere movement defects of the limbs. The mature peptide of this protein is identical in all mammals examined including human, pig, rat and mouse. SUBCELLULAR LOCATION: Secreted protein. TISSUE SPECIFICITY: Brain and peripheral tissues. SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Chicken,Human,Rat
Immunogen:
A synthetic peptide (YAEHKSHRGEY) as part of human (aa: 139-149), mouse and rat NT3 protein conjugated to BSA has been used as the immunogen.
Applications:
ELISA,IHC-Frozen,Neutralize,WB
Antibody Isotype:
IgG
Application Details:
IHC, ELISA, WB, inhibition of biological activity. A concentration of 1-10 µg/mL is recommended for IHC, ELISA, WB and inhibition of biological activity in vitro; 2-10 µg/mL (ED50) for in vivo use. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
A cross reactivity of less than 0.1% to mouse NGF, recombinant human BDNF and NT4/5 has been shown by dot blot. This antiserum is known to react with rat, chicken and human NT3.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Activity-regulated gene 3.1 protein homolog (Arg3.1) Polyclonal Antibody (Unconjugated), suitable for IHC-Frozen.
Background Info:
Arc (also termed activity-regulated cytoskeleton-associated protein or Arg3.1), is an effector immediate early gene whose upregulation has been demonstrated during events of synaptic plasticity. Arg3.1 expression is detectable in neuronal cell bodies and dendrites in the brain regions including striatum and cortex hippocampus, hypothalamus, amygdala.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
A synthetic peptide from the C terminal of human Arg3.1 protein (ARC protein) conjugated to Blue Carrier Protein. The sequence is homologous with mouse and rat form of Arg3.1.
Applications:
IHC-Frozen
Antibody Isotype:
IgG
Application Details:
IHC. A concentration of of 2-4 µg/mL is recommended for this application. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Specific for Arg3.1. Rat and Mouse. Other species not yet tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Glycerol (1:1) may be added for an additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Protein G purified IgG
Target:
Activity-regulated gene 3.1 protein homolog (Arg3.1)
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat
Immunogen:
Synthetic peptide immunogen, SNDDDSA[pS]PLHHIS
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 - 2 µg/mL).</b> Cell lysates or membrane preparations prepared from isolated brain or spinal cord tissues are recommended. This antibody works on skim milk blocked membranes, however, best results are obtained with a equal mixture of 2.5% skim milk / 2.5% highly purified BSA as blocking reagent and antibody diluent.<br><b>Immunohistochemistry (1 - 5 µg/mL).</b> Antibody has been shown to work on PFA fixed, frozen sections. TBS is preferred for buffer preparation.<br> Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid S479 in humans (S478 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Product references:
Turnbull MT et al. (2018), Acute Down-regulation of BDNF Signaling Does Not Replicate Exacerbated Amyloid-? Levels and Cognitive Impairment Induced by Cholinergic Basal Forebrain Lesion. Front Mol Neurosci. 2018 Feb 22;11:51. Species: Mouse ; Application: WB, hippocampal lysates. Matusica D et al. (2016), Inhibition of motor neuron death in vitro and in vivo by a p75 neurotrophin receptor intracellular domain fragment. J Cell Sci. 2016 Feb 1;129(3):517-30. doi: 10.1242/jcs.173864. Epub 2015 Oct 26. Species: Mouse ; Application: WB, spinal cord lysates.
Specificity:
Human TrkB (pS478). Antibody has been shown to be specific for TrkB phosphorylated on serine 478 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. Additional non-specific bands at lower molecular weight may be observed in lysates and homogenates with the antibody and these bands have not been characterized.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody is specific for TrkB serine phosphorylation at amino acid 478/479 (rodents/human). Lambda-phosphatase treatment obliterates positive staining.
The protein named TrkB (also named Neurotrophic tyrosine kinase receptor type 2 (NTRK2), GP145-TrkB or Tropomyosin-related kinase B is a receptor tyrosine kinase involved in the development and the maturation of the central and the peripheral nervous systems and is important in the regulation of neuron survival, proliferation, migration, differentiation, and synapse formation and plasticity. TrkB may also play a role in neutrophin-dependent calcium signaling in glial cells and mediate communication between neurons and glia. TrkB is the primary receptor for BDNF (brain-derived neurotrophic factor. TrkB also binds NT4 and NT3 but less efficiently. Upon ligand-binding, the receptor undergoes homodimerization, autophosphorylation and activation. TrkB activation recruits, phosphorylates and/or activates several downstream effectors including SHC1, FRS2, SH2B1, SH2B2 and PLCG1 that each regulate distinct overlapping signaling cascades within cells. Through SHC1, FRS2, SH2B1, SH2B2, these activate the GRB2-Ras-MAPK cascade that regulates, for instance, neuronal differentiation including neurite outgrowth. These same effectors also control the Ras-PI3 kinase-AKT1 signaling cascade that mainly regulates growth and survival. TrkB, via activation of PLCG1 and the downstream protein kinase C-regulated pathways, also controls synaptic plasticity, and thus plays a role in learning and memory by regulating both short term synaptic function and long-term potentiation. PLCG1 also leads to NF-Kappa-B activation and the transcription of genes involved in cell survival. One such consequence is that PLCG1 activation via TrkB is able to suppress anoikis, the apoptosis resulting from loss of cell-matrix interactions. (Reference: www.uniprot.org)
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized.
Host Animal:
Rabbit
Species Reactivity:
Chicken (Predicted),Human,Mouse,Rat (Predicted)
Immunogen:
Synthetic peptide immunogen, AKASPV[pY]LDILG
Applications:
WB
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (0.5 2 µg/mL).</b> High skim milk concentration (5%) causes suppression of pY817 signal, suggesting that 5% skim milk should be avoided as blocking buffer and antibody diluent. Strongest signal is obtained in 5% BSA blocking buffer, however, many non-specific bands are present. An equal mixture of skim milk and BSA (2.5% each) appears to provide the best compromise between signal and noise. However, optimization of blocking condition is recommended for each particular sample, with excess of BSA over skim milk likely to be beneficial for best results.<br><br>Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Detects full-length TrkB phosphorylated at amino acid Y817 in humans (Y816 in mouse and rat).
Physical State:
Solid
Positive Control:
Retinoic acid- and BDNF-treated NSC34 cells
Specificity:
Human TrkB (pY817). Antibody has been shown to be specific for TrkB phosphorylated on tyrosine 817 by phospho-peptide absorption dot blots, and on cell lysates from cell lines induced with retinoic acid and BDNF. Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only, demonstrating that the phosphorylated TrkB receptor is being detected. While not fully tested, this antibody may detect phosphorylated TrkA (pY791/794, human/rodent) and TrkC (pY834/820/859, human/mouse/rat) due to high degree of amino acid homology surrounding the phosphorylation site.
Storage:
Store lyophilized antibody at 2-8°C. After reconstitution divide into aliquots and store at -20°C for long-term storage. Store at 2-8°C short-term (up to 4 weeks) with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
Product Validation Info:
Antibody detects a clear band in retinoic acid (RA) and BDNF-treated NSC34 cell lysates at ~120 kDa only
Rabbit anti-Neuropeptide Y (NPY) Polyclonal Antibody (Unconjugated), suitable for WB, ELISA.
Background Info:
Neuropeptide Y is a 36 amino acid neurotransmitter found in the brain and autonomic nervous system. It has been associated with numerous physiologic processes in the brain, including the regulation of energy balance, memory and learning, and epilepsy. The main effect is increased food intake and decreased physical activity. It is also implicated in the secretion of gonadotrophin-release hormone. It is secreted by the hypothalamus and it is one of the most abundant peptides in the nervous system. It is also found in some chromaffin cells of the adrenal medulla. The sheep form of NPY is 94% homologous with human NPY.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat,Sheep
Immunogen:
Sheep Neuropeptide Y (29-64: NB. includes only the NPY peptide and not either of the flanking peptides) conjugated to keyhole limpet hemocyanin.
Corder KM et al. (2018) Prefrontal cortex-dependent innate behaviors are altered by selective knockdown of Gad1 in neuropeptide Y interneurons. PLoS One. 2018 Jul 19;13(7):e0200809 Application: IHC/IF, frozen sections.
Specificity:
Specificity has been confirmed by direct ELISA against the antigen. Sheep, Human, Mouse & Rat.
Storage:
Maintain lyophilized material at 2-8°C for up to 12 months. After reconstitution keep aliquots at -20°C for up to six months or at 2-8°C with an appropriate antibacterial agent for up to 4 weeks. Glycerol (1:1) may be added for additional stability. Avoid repetitive freeze/thaw cycles.
Purification:
Affinity purified on antigen column. Refer to vial label for antibody concentration after reconstitution.
GPx-P belongs to the glutathione peroxidase family which are responsible for the detoxification of hydrogen peroxide. It protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPx-P is secreted in plasma and exists as a homotetramer.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Rat
Immunogen:
A synthetic peptide (FEKGDVNGEKEQKFYTFLKN) corresponding to the amino acids 135-154 of human glutathione peroxidase 3 (GPx-P) conjugated to diphtheria toxin has been used as the immunogen. The peptide is homologous with the corresponding sequence derived from glutathione peroxidase 3 (GPx-P) protein in mouse, rat, orangutan and bovine.
Applications:
IHC-Frozen
Antibody Isotype:
Mixed
Application Details:
IHC, only. A dilution o f 1: 1000 to 1: 5000 is recommended for immunohistochemistry depending on detection method but end user will need to determine dilution to suit application. Antigen retrieval is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
This antibody has been shown to be specific for glutathione peroxidase 3 protein (GPx-P) through staining and blocking studies. Human and rat, other species have not yet been ested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles.
BDNF belongs to the neurotrophin family and promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. The alterations in BDNF expression induced by various kinds of brain insult including stress, ischemia, seizure activity and hypoglycemia, may contribute to some pathologies such as depression, epilepsy, Alzheimer's, and Parkinson's disease. Microglia release BDNF that may contribute to neuroinflammation and neuropathic pain. SUBUNIT: Monomers and homodimers. Binds to NTRK2/TRKB. SUBCELLULAR LOCATION: Secreted protein. POst translation modification: Converted into mature BDNF by plasmin (PLG). SIMILARITY: Belongs to the NGF-beta family.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from a solution containing PBS pH 7.4, 3% trehalose, with 0.05% sodium azide.
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Antibody was raised against a GST-tagged rhBDNF fusion protein and expressed in and purified from E. coli.
Applications:
ELISA
Antibody Isotype:
IgG
Application Details:
<b>Western Blotting (denaturing and reducing):</b> 0.2 to 1 µg/mL. Antibody detects 14 kDa mature BDNF monomer and 32 kDa proBDNF monomer in cell lysate and tissue homonenate. Antibody has only been tested on cell lysate and tissue homogenate of human origin. Acid-treated samples may give cleaner blots, and enhance signals for BDNF. R-1707-100 is not recommended for human serum samples. For human serum analysis, we recommend mouse monoclonal antibody to rhBDNF (M-1744-50/100), or rabbit polyclonal antibody to BDNF peptide 1-10 (R-083-100, whole serum; R-066-500, IgG).<br><br><b>Flow Cytometry:</b> ~2 µg per 10^6 cells, methanol fixation. Note: R-1707-100 cannot be used to distinguish the flow cytometry signal originating from mature BDNF versus proBDNF.<br><br>Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Brain-derived neurotrophic factor; Abrineurin
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Human, rat and mouse BDNF. Expected to detect BDNF from other species due to sequence homology. No cross-reactivity with other neurotrophins.
Storage:
Store lyophilized antibody at 2-8°C protected from moisture. After reconstitution divide antibody into useful aliquots and keep aliquots at -20°C to -80°C for a higher stability. Working aliquots can be kept at 2-8°C for up to 1 month. Avoid repetitive freeze/thaw cycles.
Rabbit anti-Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253) Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Calcium/calmodulin-stimulated protein kinase II (CaMKII) is composed of four different chains (alpha, beta, gamma, and delta) and is abundantly expressed in neurons. CaMKII is involved in regulating many aspects of neuronal function, including neurotransmitter synthesis and release, modulation of ion channel activity and cellular transport. The enzymatic function of CaMKII is regulated by its multiple phosphorylation sites and targeting to sub-cellular locations through interactions with protein binding partners. Phosphorylation of Thr253 has been identified in vivo and found to alter the interaction of CaMKII with binding partners, but not change its enzymatic activity. Thus, phosphorylation of Thr253 is suggested to modulate functional responses based on its binding partner and subsequently its sub-cellular localization.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Rat
Immunogen:
A synthetic peptide (NKmLpTINPSC) corresponding to the sequence around Thr253 (AA 249-257) in alpha-CaMKII was synthesized, purified to 95% purity by HPLC, analyzed by mass spectroscopy and coupled to diphtheria toxoid.
Applications:
WB
Antibody Isotype:
Mixed
Application Details:
Western Blotting (1:200 - 1:1000). Other applications have not been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Product references:
Skelding KA et al (2012) J J Cereb Blood Flow Metab 32 (12), 2181-2192. Skelding KA et al (2010) Cell Signal 22 (5), 759-769. Gurd JW et al (2008) Brain Res 1218, 158-165. Migues PV et al (2006) J Neurochem 98 (1), 289-299.
Specificity:
Rat Predicted from gene analysis to react with human and mouse alpha-CaMKII.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Purification:
Whole serum
Target:
Phospho-calcium/calmodulin-dependent protein kinase type II subunit alpha, Thr253 (alpha-CaMKII, Thr253)
Glyceraldehyde 3-Phosphate Dehydrogenase (GAPDH) is a metabolic enzyme responsible for catalyzing one step in the glycolytic pathway, the reversible oxidative phosphorylation of glyceraldehyde 3-phosphate. GAPDH may have other roles in the activation of transcription and in the regulation of apoptosis as well as Alzheimer's disease and Huntington's disease. The immunogen used to raise this particular antibody was extensively purified pig GAPDH. This antibody can be used as a loading control for western blotting experiments, allowing comparison between the level of this protein and others in a cell or tissue.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Full length recombinant human GAPDH expressed in and purified from E. coli
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:10,000-1:30,000 is recommended for WB. A dilution of 1:1,000-1:10,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Rabbit anti-Vimentin Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Vimentin is the major protein subunit of the 10nm or intermediate filaments protein found in many kinds of mesenchymal and epithelia cells. Vimentin is also found in many kinds of cells in tissue culture and in developing neuronal and astrocytic precursor cells in the central nervous system. Vimentin frequently forms copolymers with other intermediate filament proteins, such as GFAP (in many kinds of astrocytes), with desmin (in muscle cells) and neurofilament proteins (in developing neurons). Antibodies to vimentin are useful in studies of stem cells and generally to reveal the filamentous cytoskeleton.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Other Mammals (Predicted)
Immunogen:
Recombinant human Vimentin purified from E. coli.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (ICC). A dilution of 1:5,000 - 1:10,000 is recommended for WB. A dilution of 1:1,000-5,000 is recommended for ICC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Specific for the ~55 kDa Vimentin protein.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Lamin A/C Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The Lamin proteins are members of the intermediate filament protein family but are located inside the nucleus rather than in the cytoplasm (1). The lamins function as skeletal components tightly associated with the inner nuclear membrane. Originally the proteins of the nuclear cytoskeleton were named Lamin A, B and C, from top to bottom as visualized on SDS-PAGE gels. Subsequently it was found that Lamins A and C were coded for by a single gene (2), while the Lamin B band may contain two proteins encoded by two genes now called Lamin B1 and Lamin B2. Lamin A has a mass of about 74 kDa while Lamin C is 65 kDa. The Lamin A protein includes 98 amino acids missing from Lamin C, while Lamin C has a C-terminal 6 amino acid peptide not present in Lamin A. Apart from these regions Lamin A and C are identical so that antibodies raised against either protein are likely to cross react with the other, as is the case with this monoclonal. Lamin polymerization and depolymerization is regulated by phosphorylation by cyclin dependent protein kinase 1 (CDK1), the key component of "maturation promoting factor", the central regulator of cell division. Activity of this kinase increases during cell division and is responsible for the breakdown of the nuclear lamina. Mutations in the LMNA gene are associated with several serious human diseases, including Emery-Dreifuss muscular dystrophy, familial partial lipodystrophy, limb girdle muscular dystrophy, dilated cardiomyopathy, Charcot-Marie-Tooth disease type 2B1, and Hutchinson-Gilford progeria syndrome. This family of diseases belong to a larger group which are often referred to as Laminopathies, though some laminopathies are associated in defects in Lamin B1, B2 or one or other of the numerous nuclear lamina binding proteins. A truncated version of lamin A, commonly known as progerin, causes Hutchinson-Gilford progeria syndrome, a form of premature aging (3).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human,Other Mammals (Predicted)
Immunogen:
Full length recombinant human Lamin C
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Immunocytochemistry (ICC) and Western Blotting (WB). A dilution of 1:1,000-1:5,000 is recommended for WB. A dilution of 1:1,000-1:5,000 is recommended for ICC. The optimal dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Lamin A and Lamin C. The antibody reacts with a 74 kDa and 65 kDa band by Western blot on HeLa cell extract. It has also been used successfully for immunocytochemistry on HeLa cell cultures.
Storage:
After reconstitution of lyophilized antibody, aliquot and store at -20°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Spectrin, alpha II Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
The spectrin family of proteins were originally discovered as major components of the submembraneous cytoskeleton of osmotically lysed red blood cells (1). The lysed blood cells could be seen as clear red blood cell shaped objects in the light microscope and were referred to as red cell "ghosts". The major proteins of these ghosts proved to be actin, ankyrin, band 4.1 and several other proteins, including two major bands running at about 240 kDa and 260 kDa on SDS-PAGE gels. This pair of bands was named "spectrin" since they were discovered in these red blood cell ghosts (1). Later work showed that similar high molecular bands were seen in membrane preparations from other eukaryotic cell types. Work by Levine and Willard described a pair of about ~240-260 kDa molecular weight bands which were transported at the slowest rate along mammalian axons (2). They named these proteins "fodrin" as antibody studies showed that they were localized in the sheath under the axonal membrane, but not in the core of the axon (2; fodros is Greek for sheath). Subsequently fodrin was found to be a member of the spectrin family of proteins, and the spectrin nomenclature is now normally used (3). Spectrins form tetramers of two alpha and two beta subunits, with the alpha corresponding to the lower molecular weight ~240 kDa band and the beta corresponding to the ~260 kDa or in some case much larger band. Most spectrin tetramers are about 0.2microns or 200nm long, and each alpha and beta subunit has a cell type specific expression pattern. The basic structure of each spectrin subunit is the spectrin repeat, which is a sequence of about 110 amino acids which defines a compact domain contain three closely packed alpha-helices. Each spectrin subunit contains multiple copies of this repeat, with 20 in each of the alpha subunits. The beta I-IV subunits each contain 17 spectrin repeats, while the beta V subunit, also known as beta-heavy spectrin, contains 30 of these repeats. The various subunits also contain several other kinds of functional domain, allowing the spectrin tetramer to interact with a variety of protein, ionic and lipid targets. The alpha-subunits each contain one calmodulin like calcium binding region and one Src-homology 3 (SH3) domain, an abundant domain involved in specific protein-protein interactions. The beta subunits all have a N-terminal actin binding domain and may also have one SH3 domain and one pleckstrin homology domain, a multifunctional type of binding domain which in beta I spectrin at least binds the membrane lipid PIP2 (5). Spectrins are believed to have a function in giving mechanical strength to the plasma membrane since the tetramers associate with each other to form a dense submembraneous geodesic meshwork (3). They also bind a variety of other membrane proteins and membrane lipids, and the proteins they bind to are therefore themselves localized in the membrane. Diseases may be associated with defects in one or other of the spectrin subunits (6). For example, some forms of hereditary spherocytosis, the presence of spherical red blood cells which are prone to lysis, can be traced to mutations in some of the spectrin subunits (7). The alpha-II subunit is widely expressed in tissues but, in the nervous system, is found predominantly in neurons. The antibody can therefore be used to identify neurons and fragments derived from neuronal membranes in cells in tissue culture and in sectioned material.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized, without preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
The antibody was raised against a mix of five recombinant constructs containing the entire C-terminal region of human alpha-II spectrin (amino acids 676-2,400).
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB) and Immunocytochemistry (IC). Suggested dilution for WB is 1:5,000-10,000 and 1:500-1,000 for IC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody reacts with a 240 kDa band by Western blot on mouse sciatic nerve extract. Minor bands below may be seen and this likely represents in vivo proteolytic fragments of alpha-II spectrin. It has also been used successfully for immunocytochemistry.
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
FUNCTION: Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. SUBUNIT: Homotetramer. SUBCELLULAR LOCATION: Cytoplasm. Lysosome. Also found in lung secretory organelles. MISCELLANEOUS: The active site is the redox-active Cys-47 oxidized to Cys-SOH. Cys-SOH may rapidly react with a Cys-SH of the other subunit to form an intermolecular disulfide with a concomitant homodimer formation. The enzyme may be subsequently regenerated by reduction of the disulfide by thioredoxin . MISCELLANEOUS: Irreversibly inactivated by overoxidation of Cys-47 (to Cys-SO(3)H) upon oxidative stress. SIMILARITY: Belongs to the ahpC/TSA family. Rehydrin subfamily.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse,Rat
Immunogen:
Rat recombinant Peroxiredoxin-6. The sequence is homologous in human and mouse peroxiredoxin-6.
Applications:
ELISA,ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB, ELISA. This antibody works superbly in Immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. A dilution of 1: 1000 to 1: 4000 is recommended for ELISA. This antiserum stains the cytoplasm of epithelial cells in the rat and mouse lung and rat and human brain astrocytes. It stains human brain astrocytes in Parkinson's and Alzheimer 's disease and the central core of some Lewy bodies in Parkinson's disease and dementia with Lewy bodies. Other tissues have not yet been tested. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Walsh B. et al. (2010) Overexpression of Prdx6 and resistance to peroxide-induced death in Hepa1-6 cells: Prdx suppression increases apoptosis. Redox Rep. 2009;14(6):275-84. Gardiner F. et al. (2010) Induction of Prdx1 and Prdx6 in Liver Cellsby Serum and TPA. Intl J. Biol. Vol. 2, No. 1
Specificity:
This antibody has been shown to be specific for Peroxiredoxin-6 protein. Rat, human and mouse, other species have not yet been tested.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
Rabbit anti-Adenylate cyclase type III (ACIII) Polyclonal Antibody (Unconjugated), suitable for WB, IHC, ICC.
Background Info:
Adenylate cyclases are enzymes which interact with and are activated by the GTP bound alpha subunits of trimeric G-proteins. Activated adenylate cyclases are responsible for the production of the important "second messenger" signalling molecule cyclic-AMP, which is generated from ATP. The type III adenylate cyclase enzyme is localized in the membranes surrounding the cilia in neurons, and our antibody is an excellent marker of neuronal cilia in the brain and in cells in tissue culture. Adenylate cyclase type III is a large complex molecule of, in the human, 1145 amino acids with a deduced molecular weight of 129 kDa. The protein may be variably glycosylated, so that on SDS-PAGE and western blots it runs as a diffuse band of about 160 kDa in cortex and about 200 kDa in olfactory epithelium. The molecule has a complex structure, with 12 transmembrane domains and two cyclase domains. Each cyclase domain is immediately C-terminal to 6 transmembrane segments, but only the second, C-terminal cyclase is believed to be catalytically active.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS buffer pH 7.2-7.6 with 0.1% trehalose, without preservatives
Host Animal:
Rabbit
Species Reactivity:
Human (Predicted),Mouse,Other Mammals (Predicted),Rat
Immunogen:
20 amino acid peptide identical to the C-terminus of rat ACIII (amino acids PAAFPNGSSVTLPHQVVDNP)
Applications:
ICC,IHC,WB
Antibody Isotype:
IgG
Application Details:
Western Blotting (WB), Immunocytochemistry (ICC) and Immunohistochemistry (IHC). A dilution of 1:1,000-1:2,000 is recommended for WB. A dilution of 1:5,000-1:10,000 is recommended for ICC and IHC. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
The antibody stains a band at about 200 kDa in olfactory epithelium which is rich in cilia. Fewer cilia are found in frontal cortex, and the protein is less heavily glycosylated, and a less prominent band is seen at about 160 kDa. It has also been used successfully for immunocytochemistry on mixed neuron/glia cultures. The antibody has been directly tested for reactivity in rat. It is expected that it will work on human due to homology with the immunogen and possibly other mammal tissues (Human, horse, cow, pig, chicken, mouse).
Storage:
Store lyophilized, unopened vial at 2-8°C or lower. After reconstitution, prepare aliquots and store at -20°C to -80°C for a higher stability. Avoid freeze-thaw cycles.
Rabbit anti-Nicastrin, N-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (RGNSVERKIYIPL-C) corresponding to human Nicastrin [32-44] in the N-terminal region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, Central region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody reacts with immature forms of Nicastrin. Detection of higher mol. wt. mature forms is likely to be blocked by glycosylation in this region of the protein.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-QGETFDYIGSSRMVYD) corresponding to human Nicastrin [331-346] in the central region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50 mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo removal/cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Nicastrin, C-terminal Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Nicastrin, a type 1 membrane glycoprotein, is an essential component of the gamma secretase complex which is critical for the cleavage of the amyloid precursor protein and other membrane proteins. Nicastrin is widely expressed in different tissue types. This antibody detects all processed forms of Nicastrin.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A synthetic peptide (C-NAKADVLFIAPREPGAVSY) corresponding to human Nicastrin [691-709] in the C-terminal region conjugated via additional N-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested concentration of 3-10 µg/mL is recommended for WB. Human or mouse brain samples commonly prepared with reducing (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Unprocessed full length human Nicastrin is 709 amino acids, however this protein contains an N-terminal signal peptide which is considered to undergo cleavage during processing and transit to the cell plasma membrane, in addition the protein undergoes glycosylation to produce a glycoprotein of about 145 kDa apparent MW by SDS PAGE. Biosensis recommends that the optimal working dilution should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Beta-synuclein Polyclonal Antibody (Unconjugated), suitable for WB, IHC-Frozen.
Background Info:
Beta-synuclein is a soluble cytoplasmic protein associated with synaptic vesicles and a member of the synuclein family. Mutations in alpha-synuclein cause early onset Parkinson's disease. Expression of beta synuclein may modulate alpha-synuclein aggregation found in Parkinson's disease.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (AQEAAEEPLIEPLME-C) corresponding to human _-synuclein [99-113] in the C-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
IHC-Frozen,WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. A dilution of 1:500 to 1:1,000 is recommended for Western blot. _-synuclein is a soluble protein of 134 amino acids and detected with 17 kDa mobility by western blotting. By IHC the antibody detects synaptic sites in human brain formaldehyde-treated frozen tissue. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption. Does not detect alpha-synuclein as tested with recombinant protein and does not react with Lewy bodies in human Dementia with Lewy Bodies or Parkinson's disease brain tissue sections.
Storage:
Lyophilized at 2-8°C. After reconstitution, store at -20°C in undiluted aliquots for up to 6 months. The antibody may be stored short term at 2-2-8°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles.
Rabbit anti-DJ-1/PARK7 Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Autosomal recessive mutations in DJ-1 cause early-onset familial Parkinson's disease. DJ-1 is considered a redox-sensitive cytoplasmic protein found in brain as well as other cell types.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (ASKRALVILAKGAEE-C) corresponding to human DJ-1 [2-16] in the N-terminal domain conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
WB and IHC. Suggested dilution of 1:5,000 is recommended for WB. DJ-1 is a soluble protein of 189 amino acids and detected with 23 kDa mobility by western blotting. The suggested dilution for IHC is 1:100. Detected astrocyte cytoplasmic labelling in human brain formaldehyde-treated tissue. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
PARK7
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by WB using soluble mouse and human brain extracts, reactivity for major product diminished by peptide absorption.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 2 loop region Polyclonal Antibody (Unconjugated), suitable for WB, ICC.
Background Info:
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
ICC,WB
Antibody Isotype:
IgG
Application Details:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
AD3LP, AD5, E5-1, STM-2
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
Rabbit anti-Presenilin 1 loop region Polyclonal Antibody (Unconjugated), suitable for WB.
Background Info:
Presenilin-1 (PSEN1) is a multi-pass membrane protein and component of the gamma-secretase complex. PSEN1 is thought to play a role in intracellular signaling and gene expression or in linking chromatin to the nuclear membrane. It may also play a role in hematopoiesis. Defects in PSEN1 are a cause of Alzheimer disease type 3 (AD3), a familial early-onset form of Alzheimer disease (Ref:SWISS-Prot).
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized from PBS, pH 7.4. Contains no preservative.
Host Animal:
Rabbit
Species Reactivity:
Human,Mouse
Immunogen:
A synthetic peptide (GDPEAQRRVSKNSKYNA-C) corresponding to human PS1 [301-317] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western Blot. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 1 (467 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 19 kDa. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. Biosensis recommends that the optimal working dilution should be determined by the end user.
Alternative Names:
Presenilin 1; PS-1; Protein S182; PS1-CTF12; PSEN1; AD3; PS1; PSNL1
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
Confirmed by Western blotting using transfected cells, presenilin 1 knock-out mouse cells and mouse and human brain.
Storage:
Short term storage at 2-8°C for one week. At -20°C as an undiluted liquid for up to 12 months.
SOD1 binds copper and zinc ions ans is one of two isozymes responsible for destroying free superoxide radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 is a soluble cytoplasmic protein, acting as a homodimer to convert superoxide radicals to molecular oxygen and hydrogen peroxide. Defects in SOD1 are the cause of amyotrophic lateral sclerosis type 1 (ALS1) which is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Lyophilized
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
A peptide (HEKADDLGKGGNEESTKTG) corresponding to the amino acids 121-139 of human superoxide dismutase (SOD1) conjugated to diphtheria toxin has been used as the immunogen.
Applications:
ICC,IHC-Frozen,IHC-Paraffin-embedded,WB
Antibody Isotype:
Mixed
Application Details:
IHC, WB. This antibody works superbly in immunohistochemistry on frozen or paraffin embedded tissues. Antigen retrieval has been used in testing but may not be necessary. Typical working dilutions for routine immunohistochemistry are 1: 100 to 1: 1000 depending on tissue and detection method. For western blotting a dilution range of 1: 1000 to 1: 4000 is recommended. Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
Superoxide dismutase; SOD1;
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
This antibody has been shown to be specific for superoxide dismutase (SOD1) protein. Human. Does not detect mouse and rat SOD1.
Storage:
After reconstitution keep aliquots at -20°C for a higher stability, and at 2-8°C with an appropriate antibacterial agent. Avoid repetitive freeze/thaw cycles. Glycerol (1:1) may be added for an additional stability.
MANF is a trophic factor for midbrain dopamine neurons in vivo. It prevents the 6-OHDA- induced degeneration of dopamine neurons in rodent models of Parkinson's disease (Lindholm et al., 2008, Voutilainen et al., 2009). When administered after 6-OHDA-lesioning it restores the dopaminergic function and prevents degeneration of dopamine neurons in substantia nigra pars compacta.
Product Type:
Antibody
Antibody Type:
Polyclonal
Format:
Concentrated ammonium sulfate in PBS pH 7.4 containing no preservatives.
Host Animal:
Rabbit
Species Reactivity:
Human
Immunogen:
Recombinant human MANF protein produced using CHO-based cell line. Immunogen is purified from cell culture supernatant.
Applications:
WB
Antibody Isotype:
IgG
Application Details:
Western blot (WB) at a suggested dilution of 1:2,000 - 1:6,000. Immunohistochemistry (IHC) and Immunofluorescence (IF). Biosensis recommends optimal dilutions/concentrations should be determined by the end user.
Alternative Names:
ARMET, ARP
Biosensis Brand:
Biosensis®
Conjugate:
Unconjugated
Shelf Life:
12 months after date of receipt (unopened vial).
Use:
For research use only.
Specificity:
MANF (Mesencephalic astrocyte-derived neurotrophic factor). No cross-reactivity in MANF-knockout mouse. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB. No cross-reactivity with CDNF in IHC, slightly cross-reacts with purified CDNF in WB.
Storage:
Store antibody stock solution at 2-8°C upon receipt. DO NOT FREEZE. This product is an (NH4)2SO4 precipitate. See reconstitution instructions for more information.
X
We use cookies to help personalise and improve your web experience.
By using our website you consent to our use of cookies, some of which may have already been set on your device.
View our Cookie Policy to learn more.